Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1042207..1042858 | Replicon | chromosome |
| Accession | NZ_CP107605 | ||
| Organism | Acinetobacter baumannii strain 1326924-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | OIO60_RS05015 | Protein ID | WP_000838146.1 |
| Coordinates | 1042207..1042389 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0J1AAF8 |
| Locus tag | OIO60_RS05020 | Protein ID | WP_000966689.1 |
| Coordinates | 1042454..1042858 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO60_RS04970 (OIO60_04970) | 1037464..1038129 | + | 666 | WP_000767881.1 | Ish1 domain-containing protein | - |
| OIO60_RS04975 (OIO60_04975) | 1038134..1038523 | + | 390 | WP_000008492.1 | hypothetical protein | - |
| OIO60_RS04980 (OIO60_04980) | 1038525..1038893 | + | 369 | WP_000524231.1 | hypothetical protein | - |
| OIO60_RS04985 (OIO60_04985) | 1038902..1039306 | + | 405 | WP_000248324.1 | hypothetical protein | - |
| OIO60_RS04990 (OIO60_04990) | 1039278..1039646 | + | 369 | WP_000539752.1 | hypothetical protein | - |
| OIO60_RS04995 (OIO60_04995) | 1039648..1040046 | + | 399 | WP_001132270.1 | hypothetical protein | - |
| OIO60_RS05000 (OIO60_05000) | 1040048..1040260 | + | 213 | WP_000121166.1 | hypothetical protein | - |
| OIO60_RS05005 (OIO60_05005) | 1040368..1041297 | + | 930 | WP_000094300.1 | phage tail tube protein | - |
| OIO60_RS05010 (OIO60_05010) | 1041342..1041875 | + | 534 | WP_001185622.1 | hypothetical protein | - |
| OIO60_RS05015 (OIO60_05015) | 1042207..1042389 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OIO60_RS05020 (OIO60_05020) | 1042454..1042858 | + | 405 | WP_000966689.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OIO60_RS05025 (OIO60_05025) | 1042939..1043340 | + | 402 | WP_000720591.1 | hypothetical protein | - |
| OIO60_RS05030 (OIO60_05030) | 1043401..1047366 | + | 3966 | WP_000191304.1 | tape measure protein | - |
| OIO60_RS05035 (OIO60_05035) | 1047484..1047825 | + | 342 | WP_001281459.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1011814..1066429 | 54615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T261796 WP_000838146.1 NZ_CP107605:1042207-1042389 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14769.78 Da Isoelectric Point: 4.5000
>AT261796 WP_000966689.1 NZ_CP107605:1042454-1042858 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S3TWT7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1AAF8 |