Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 475464..476117 | Replicon | chromosome |
Accession | NZ_CP107605 | ||
Organism | Acinetobacter baumannii strain 1326924-1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OIO60_RS02330 | Protein ID | WP_000607077.1 |
Coordinates | 475728..476117 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OIO60_RS02325 | Protein ID | WP_001288210.1 |
Coordinates | 475464..475721 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO60_RS02305 (OIO60_02305) | 470980..471987 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
OIO60_RS02310 (OIO60_02310) | 472006..472383 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OIO60_RS02315 (OIO60_02315) | 472565..474055 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OIO60_RS02320 (OIO60_02320) | 474104..475276 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
OIO60_RS02325 (OIO60_02325) | 475464..475721 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OIO60_RS02330 (OIO60_02330) | 475728..476117 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
OIO60_RS02335 (OIO60_02335) | 476887..477972 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
OIO60_RS02340 (OIO60_02340) | 478050..478616 | + | 567 | WP_000651538.1 | rhombosortase | - |
OIO60_RS02345 (OIO60_02345) | 478804..480999 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T261795 WP_000607077.1 NZ_CP107605:475728-476117 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|