Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 14032..14620 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107604 | ||
| Organism | Acinetobacter baumannii strain 1326595 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
| Locus tag | OIO71_RS19205 | Protein ID | WP_000438827.1 |
| Coordinates | 14032..14319 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | OIO71_RS19210 | Protein ID | WP_001983304.1 |
| Coordinates | 14306..14620 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO71_RS19175 (OIO71_19180) | 9177..9512 | + | 336 | WP_000064659.1 | DUF6388 family protein | - |
| OIO71_RS19180 (OIO71_19185) | 9625..9771 | - | 147 | WP_001983317.1 | hypothetical protein | - |
| OIO71_RS19185 (OIO71_19190) | 10357..10632 | + | 276 | WP_001133626.1 | metal/formaldehyde-sensitive transcriptional repressor | - |
| OIO71_RS19190 (OIO71_19195) | 10654..11763 | + | 1110 | WP_000842148.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| OIO71_RS19195 (OIO71_19200) | 11816..12214 | + | 399 | WP_000235176.1 | VOC family protein | - |
| OIO71_RS19200 (OIO71_19205) | 12688..13521 | + | 834 | WP_000439570.1 | S-formylglutathione hydrolase | - |
| OIO71_RS19205 (OIO71_19210) | 14032..14319 | + | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
| OIO71_RS19210 (OIO71_19215) | 14306..14620 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| OIO71_RS19215 (OIO71_19220) | 14748..17159 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
| OIO71_RS19220 (OIO71_19225) | 17464..17925 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
| OIO71_RS19225 (OIO71_19230) | 18251..18460 | - | 210 | WP_000069474.1 | hypothetical protein | - |
| OIO71_RS19230 (OIO71_19235) | 18453..18755 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | - |
| OIO71_RS19235 (OIO71_19240) | 18748..19104 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..19662 | 19662 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261794 WP_000438827.1 NZ_CP107604:14032-14319 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J8TIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |