Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2618535..2619186 Replicon chromosome
Accession NZ_CP107599
Organism Acinetobacter baumannii strain 1326584

Toxin (Protein)


Gene name hicA Uniprot ID A0A5Q0RPK1
Locus tag OIO43_RS12405 Protein ID WP_000838147.1
Coordinates 2619004..2619186 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A335N5K1
Locus tag OIO43_RS12400 Protein ID WP_000966690.1
Coordinates 2618535..2618939 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIO43_RS12380 (OIO43_12380) 2616948..2617349 - 402 WP_000758222.1 hypothetical protein -
OIO43_RS12385 (OIO43_12385) 2617361..2617894 - 534 WP_000719143.1 hypothetical protein -
OIO43_RS12390 (OIO43_12390) 2617928..2618251 - 324 WP_000523922.1 DUF4236 domain-containing protein -
OIO43_RS12395 (OIO43_12395) 2618260..2618436 - 177 WP_001983384.1 hypothetical protein -
OIO43_RS12400 (OIO43_12400) 2618535..2618939 - 405 WP_000966690.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OIO43_RS12405 (OIO43_12405) 2619004..2619186 - 183 WP_000838147.1 type II toxin-antitoxin system HicA family toxin Toxin
OIO43_RS12410 (OIO43_12410) 2619255..2619515 - 261 WP_074163942.1 hypothetical protein -
OIO43_RS12415 (OIO43_12415) 2619518..2620051 - 534 WP_001185621.1 hypothetical protein -
OIO43_RS12420 (OIO43_12420) 2620099..2621028 - 930 WP_000094301.1 phage tail tube protein -
OIO43_RS12425 (OIO43_12425) 2621136..2621348 - 213 WP_001983388.1 hypothetical protein -
OIO43_RS12430 (OIO43_12430) 2621350..2621748 - 399 WP_001251842.1 phage tail terminator-like protein -
OIO43_RS12435 (OIO43_12435) 2621750..2622118 - 369 WP_001983390.1 hypothetical protein -
OIO43_RS12440 (OIO43_12440) 2622084..2622497 - 414 WP_000626004.1 hypothetical protein -
OIO43_RS12445 (OIO43_12445) 2622565..2623227 - 663 WP_001284678.1 hypothetical protein -
OIO43_RS12450 (OIO43_12450) 2623266..2623634 - 369 WP_000524219.1 hypothetical protein -
OIO43_RS12455 (OIO43_12455) 2623634..2624014 - 381 WP_000505832.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6682.88 Da        Isoelectric Point: 10.6602

>T261789 WP_000838147.1 NZ_CP107599:c2619186-2619004 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPSGTVKSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14605.61 Da        Isoelectric Point: 4.4169

>AT261789 WP_000966690.1 NZ_CP107599:c2618939-2618535 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASDLAKFVDDPDYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q0RPK1

Antitoxin

Source ID Structure
AlphaFold DB A0A335N5K1

References