Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2618535..2619186 | Replicon | chromosome |
| Accession | NZ_CP107599 | ||
| Organism | Acinetobacter baumannii strain 1326584 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A5Q0RPK1 |
| Locus tag | OIO43_RS12405 | Protein ID | WP_000838147.1 |
| Coordinates | 2619004..2619186 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A335N5K1 |
| Locus tag | OIO43_RS12400 | Protein ID | WP_000966690.1 |
| Coordinates | 2618535..2618939 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO43_RS12380 (OIO43_12380) | 2616948..2617349 | - | 402 | WP_000758222.1 | hypothetical protein | - |
| OIO43_RS12385 (OIO43_12385) | 2617361..2617894 | - | 534 | WP_000719143.1 | hypothetical protein | - |
| OIO43_RS12390 (OIO43_12390) | 2617928..2618251 | - | 324 | WP_000523922.1 | DUF4236 domain-containing protein | - |
| OIO43_RS12395 (OIO43_12395) | 2618260..2618436 | - | 177 | WP_001983384.1 | hypothetical protein | - |
| OIO43_RS12400 (OIO43_12400) | 2618535..2618939 | - | 405 | WP_000966690.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OIO43_RS12405 (OIO43_12405) | 2619004..2619186 | - | 183 | WP_000838147.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OIO43_RS12410 (OIO43_12410) | 2619255..2619515 | - | 261 | WP_074163942.1 | hypothetical protein | - |
| OIO43_RS12415 (OIO43_12415) | 2619518..2620051 | - | 534 | WP_001185621.1 | hypothetical protein | - |
| OIO43_RS12420 (OIO43_12420) | 2620099..2621028 | - | 930 | WP_000094301.1 | phage tail tube protein | - |
| OIO43_RS12425 (OIO43_12425) | 2621136..2621348 | - | 213 | WP_001983388.1 | hypothetical protein | - |
| OIO43_RS12430 (OIO43_12430) | 2621350..2621748 | - | 399 | WP_001251842.1 | phage tail terminator-like protein | - |
| OIO43_RS12435 (OIO43_12435) | 2621750..2622118 | - | 369 | WP_001983390.1 | hypothetical protein | - |
| OIO43_RS12440 (OIO43_12440) | 2622084..2622497 | - | 414 | WP_000626004.1 | hypothetical protein | - |
| OIO43_RS12445 (OIO43_12445) | 2622565..2623227 | - | 663 | WP_001284678.1 | hypothetical protein | - |
| OIO43_RS12450 (OIO43_12450) | 2623266..2623634 | - | 369 | WP_000524219.1 | hypothetical protein | - |
| OIO43_RS12455 (OIO43_12455) | 2623634..2624014 | - | 381 | WP_000505832.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6682.88 Da Isoelectric Point: 10.6602
>T261789 WP_000838147.1 NZ_CP107599:c2619186-2619004 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPSGTVKSILKQAGLK
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPSGTVKSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14605.61 Da Isoelectric Point: 4.4169
>AT261789 WP_000966690.1 NZ_CP107599:c2618939-2618535 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASDLAKFVDDPDYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGTDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASDLAKFVDDPDYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q0RPK1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A335N5K1 |