Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2616352..2617003 Replicon chromosome
Accession NZ_CP107593
Organism Acinetobacter baumannii strain 1326580

Toxin (Protein)


Gene name hicA Uniprot ID A0A5Q0RPK1
Locus tag OIO74_RS12430 Protein ID WP_000838147.1
Coordinates 2616821..2617003 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A335N5K1
Locus tag OIO74_RS12425 Protein ID WP_000966690.1
Coordinates 2616352..2616756 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIO74_RS12405 (OIO74_12405) 2614765..2615166 - 402 WP_000758222.1 hypothetical protein -
OIO74_RS12410 (OIO74_12410) 2615178..2615711 - 534 WP_000719143.1 hypothetical protein -
OIO74_RS12415 (OIO74_12415) 2615745..2616068 - 324 WP_000523922.1 DUF4236 domain-containing protein -
OIO74_RS12420 (OIO74_12420) 2616077..2616253 - 177 WP_001983384.1 hypothetical protein -
OIO74_RS12425 (OIO74_12425) 2616352..2616756 - 405 WP_000966690.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OIO74_RS12430 (OIO74_12430) 2616821..2617003 - 183 WP_000838147.1 type II toxin-antitoxin system HicA family toxin Toxin
OIO74_RS12435 (OIO74_12435) 2617072..2617332 - 261 WP_074163942.1 hypothetical protein -
OIO74_RS12440 (OIO74_12440) 2617335..2617868 - 534 WP_001185621.1 hypothetical protein -
OIO74_RS12445 (OIO74_12445) 2617916..2618845 - 930 WP_000094301.1 phage tail tube protein -
OIO74_RS12450 (OIO74_12450) 2618953..2619165 - 213 WP_001983388.1 hypothetical protein -
OIO74_RS12455 (OIO74_12455) 2619167..2619565 - 399 WP_001251842.1 phage tail terminator-like protein -
OIO74_RS12460 (OIO74_12460) 2619567..2619935 - 369 WP_001983390.1 hypothetical protein -
OIO74_RS12465 (OIO74_12465) 2619901..2620314 - 414 WP_000626004.1 hypothetical protein -
OIO74_RS12470 (OIO74_12470) 2620382..2621044 - 663 WP_001284678.1 hypothetical protein -
OIO74_RS12475 (OIO74_12475) 2621083..2621451 - 369 WP_000524219.1 hypothetical protein -
OIO74_RS12480 (OIO74_12480) 2621451..2621831 - 381 WP_000505832.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2584913..2641931 57018


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6682.88 Da        Isoelectric Point: 10.6602

>T261781 WP_000838147.1 NZ_CP107593:c2617003-2616821 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPSGTVKSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14605.61 Da        Isoelectric Point: 4.4169

>AT261781 WP_000966690.1 NZ_CP107593:c2616756-2616352 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASDLAKFVDDPDYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q0RPK1

Antitoxin

Source ID Structure
AlphaFold DB A0A335N5K1

References