Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 464650..465303 | Replicon | chromosome |
Accession | NZ_CP107593 | ||
Organism | Acinetobacter baumannii strain 1326580 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OIO74_RS02285 | Protein ID | WP_000607096.1 |
Coordinates | 464914..465303 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OIO74_RS02280 | Protein ID | WP_001288210.1 |
Coordinates | 464650..464907 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO74_RS02260 (OIO74_02260) | 460166..461173 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
OIO74_RS02265 (OIO74_02265) | 461192..461569 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OIO74_RS02270 (OIO74_02270) | 461751..463241 | + | 1491 | WP_000415137.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OIO74_RS02275 (OIO74_02275) | 463290..464462 | - | 1173 | WP_001190543.1 | acyl-CoA dehydrogenase family protein | - |
OIO74_RS02280 (OIO74_02280) | 464650..464907 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OIO74_RS02285 (OIO74_02285) | 464914..465303 | + | 390 | WP_000607096.1 | hypothetical protein | Toxin |
OIO74_RS02290 (OIO74_02290) | 466073..467158 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
OIO74_RS02295 (OIO74_02295) | 467236..467802 | + | 567 | WP_000651536.1 | rhombosortase | - |
OIO74_RS02300 (OIO74_02300) | 467990..470185 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15583.80 Da Isoelectric Point: 10.4637
>T261779 WP_000607096.1 NZ_CP107593:464914-465303 [Acinetobacter baumannii]
MINHSNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHSNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|