Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3499353..3500006 | Replicon | chromosome |
| Accession | NZ_CP107590 | ||
| Organism | Acinetobacter baumannii strain 1326569 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OIO44_RS16875 | Protein ID | WP_000607077.1 |
| Coordinates | 3499353..3499742 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OIO44_RS16880 | Protein ID | WP_001288210.1 |
| Coordinates | 3499749..3500006 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO44_RS16860 (OIO44_16865) | 3494471..3496666 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
| OIO44_RS16865 (OIO44_16870) | 3496854..3497420 | - | 567 | WP_000651538.1 | rhombosortase | - |
| OIO44_RS16870 (OIO44_16875) | 3497498..3498583 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| OIO44_RS16875 (OIO44_16880) | 3499353..3499742 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
| OIO44_RS16880 (OIO44_16885) | 3499749..3500006 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OIO44_RS16885 (OIO44_16890) | 3500194..3501366 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| OIO44_RS16890 (OIO44_16895) | 3501415..3502905 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OIO44_RS16895 (OIO44_16900) | 3503087..3503464 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OIO44_RS16900 (OIO44_16905) | 3503483..3504490 | - | 1008 | WP_264252364.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T261776 WP_000607077.1 NZ_CP107590:c3499742-3499353 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|