Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2932552..2933203 | Replicon | chromosome |
| Accession | NZ_CP107590 | ||
| Organism | Acinetobacter baumannii strain 1326569 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | OIO44_RS14190 | Protein ID | WP_000838146.1 |
| Coordinates | 2933021..2933203 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0J1AAF8 |
| Locus tag | OIO44_RS14185 | Protein ID | WP_000966689.1 |
| Coordinates | 2932552..2932956 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO44_RS14170 (OIO44_14175) | 2927585..2927926 | - | 342 | WP_001281459.1 | phage tail protein | - |
| OIO44_RS14175 (OIO44_14180) | 2928044..2932009 | - | 3966 | WP_000191304.1 | tape measure protein | - |
| OIO44_RS14180 (OIO44_14185) | 2932070..2932471 | - | 402 | WP_000720591.1 | hypothetical protein | - |
| OIO44_RS14185 (OIO44_14190) | 2932552..2932956 | - | 405 | WP_000966689.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OIO44_RS14190 (OIO44_14195) | 2933021..2933203 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OIO44_RS14195 (OIO44_14200) | 2933535..2934068 | - | 534 | WP_001185622.1 | hypothetical protein | - |
| OIO44_RS14200 (OIO44_14205) | 2934113..2935042 | - | 930 | WP_000094300.1 | phage tail tube protein | - |
| OIO44_RS14205 (OIO44_14210) | 2935150..2935362 | - | 213 | WP_000121166.1 | hypothetical protein | - |
| OIO44_RS14210 (OIO44_14215) | 2935364..2935762 | - | 399 | WP_001132270.1 | hypothetical protein | - |
| OIO44_RS14215 (OIO44_14220) | 2935764..2936132 | - | 369 | WP_000539752.1 | hypothetical protein | - |
| OIO44_RS14220 (OIO44_14225) | 2936104..2936508 | - | 405 | WP_000248324.1 | hypothetical protein | - |
| OIO44_RS14225 (OIO44_14230) | 2936517..2936885 | - | 369 | WP_000524231.1 | hypothetical protein | - |
| OIO44_RS14230 (OIO44_14235) | 2936887..2937276 | - | 390 | WP_000008492.1 | hypothetical protein | - |
| OIO44_RS14235 (OIO44_14240) | 2937281..2937946 | - | 666 | WP_000767881.1 | Ish1 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2908981..2971044 | 62063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T261775 WP_000838146.1 NZ_CP107590:c2933203-2933021 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14769.78 Da Isoelectric Point: 4.5000
>AT261775 WP_000966689.1 NZ_CP107590:c2932956-2932552 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA
MLYPIAIERGTDTEAFGVSVPDIPGCFSAGDTLYEAIENVKEAISGHLEILAEDGEEIPLASDVSKFIDQEDYRGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDDNVGKDKRFKTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S3TWT7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1AAF8 |