Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3493809..3494462 | Replicon | chromosome |
Accession | NZ_CP107587 | ||
Organism | Acinetobacter baumannii strain 1326527-2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OIO39_RS16845 | Protein ID | WP_000607077.1 |
Coordinates | 3493809..3494198 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OIO39_RS16850 | Protein ID | WP_001288210.1 |
Coordinates | 3494205..3494462 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO39_RS16830 (OIO39_16825) | 3488927..3491122 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
OIO39_RS16835 (OIO39_16830) | 3491310..3491876 | - | 567 | WP_000651538.1 | rhombosortase | - |
OIO39_RS16840 (OIO39_16835) | 3491954..3493039 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
OIO39_RS16845 (OIO39_16840) | 3493809..3494198 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
OIO39_RS16850 (OIO39_16845) | 3494205..3494462 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OIO39_RS16855 (OIO39_16850) | 3494650..3495822 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
OIO39_RS16860 (OIO39_16855) | 3495871..3497361 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OIO39_RS16865 (OIO39_16860) | 3497543..3497920 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OIO39_RS16870 (OIO39_16865) | 3497939..3498946 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T261772 WP_000607077.1 NZ_CP107587:c3494198-3493809 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|