Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3490643..3491296 | Replicon | chromosome |
| Accession | NZ_CP107585 | ||
| Organism | Acinetobacter baumannii strain 1326527-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OIO72_RS16770 | Protein ID | WP_025467596.1 |
| Coordinates | 3490643..3491032 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OIO72_RS16775 | Protein ID | WP_001288210.1 |
| Coordinates | 3491039..3491296 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO72_RS16755 (OIO72_16760) | 3485761..3487956 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| OIO72_RS16760 (OIO72_16765) | 3488144..3488710 | - | 567 | WP_000651536.1 | rhombosortase | - |
| OIO72_RS16765 (OIO72_16770) | 3488788..3489873 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| OIO72_RS16770 (OIO72_16775) | 3490643..3491032 | - | 390 | WP_025467596.1 | membrane protein | Toxin |
| OIO72_RS16775 (OIO72_16780) | 3491039..3491296 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OIO72_RS16780 (OIO72_16785) | 3491484..3492656 | + | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
| OIO72_RS16785 (OIO72_16790) | 3492705..3494195 | - | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OIO72_RS16790 (OIO72_16795) | 3494377..3494754 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OIO72_RS16795 (OIO72_16800) | 3494773..3495780 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T261768 WP_025467596.1 NZ_CP107585:c3491032-3490643 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|