Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 14035..14623 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107584 | ||
| Organism | Acinetobacter baumannii strain 1326525-3 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
| Locus tag | OIO75_RS19145 | Protein ID | WP_000438827.1 |
| Coordinates | 14035..14322 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | OIO75_RS19150 | Protein ID | WP_001983304.1 |
| Coordinates | 14309..14623 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO75_RS19120 (OIO75_19125) | 11893..12105 | + | 213 | WP_000687427.1 | hypothetical protein | - |
| OIO75_RS19125 (OIO75_19130) | 12387..12563 | + | 177 | WP_000246872.1 | hypothetical protein | - |
| OIO75_RS19130 (OIO75_19135) | 12599..13093 | + | 495 | WP_000999995.1 | hypothetical protein | - |
| OIO75_RS19135 (OIO75_19140) | 13108..13392 | - | 285 | WP_001071102.1 | hypothetical protein | - |
| OIO75_RS19140 (OIO75_19145) | 13486..13788 | + | 303 | WP_000702763.1 | hypothetical protein | - |
| OIO75_RS19145 (OIO75_19150) | 14035..14322 | + | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
| OIO75_RS19150 (OIO75_19155) | 14309..14623 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| OIO75_RS19155 (OIO75_19160) | 14751..17162 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
| OIO75_RS19160 (OIO75_19165) | 17467..17926 | + | 460 | Protein_20 | DIP1984 family protein | - |
| OIO75_RS19165 (OIO75_19170) | 18252..18461 | - | 210 | WP_000069474.1 | hypothetical protein | - |
| OIO75_RS19170 (OIO75_19175) | 18454..18756 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | - |
| OIO75_RS19175 (OIO75_19180) | 18749..19105 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..19663 | 19663 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261767 WP_000438827.1 NZ_CP107584:14035-14322 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J8TIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |