Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 5039..5627 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107582 | ||
| Organism | Acinetobacter baumannii strain 1326525-2 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
| Locus tag | OIO86_RS19105 | Protein ID | WP_000438827.1 |
| Coordinates | 5340..5627 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | OIO86_RS19100 | Protein ID | WP_001983304.1 |
| Coordinates | 5039..5353 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO86_RS19075 (OIO86_19080) | 555..911 | + | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OIO86_RS19080 (OIO86_19085) | 904..1206 | + | 303 | WP_001140621.1 | XRE family transcriptional regulator | - |
| OIO86_RS19085 (OIO86_19090) | 1199..1408 | + | 210 | WP_000069474.1 | hypothetical protein | - |
| OIO86_RS19090 (OIO86_19095) | 1734..2195 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| OIO86_RS19095 (OIO86_19100) | 2500..4911 | - | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
| OIO86_RS19100 (OIO86_19105) | 5039..5353 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| OIO86_RS19105 (OIO86_19110) | 5340..5627 | - | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
| OIO86_RS19110 (OIO86_19115) | 5874..6176 | - | 303 | WP_000702763.1 | hypothetical protein | - |
| OIO86_RS19115 (OIO86_19120) | 6270..6554 | + | 285 | WP_001071102.1 | hypothetical protein | - |
| OIO86_RS19120 (OIO86_19125) | 6569..7063 | - | 495 | WP_000999995.1 | hypothetical protein | - |
| OIO86_RS19125 (OIO86_19130) | 7099..7275 | - | 177 | WP_000246872.1 | hypothetical protein | - |
| OIO86_RS19130 (OIO86_19135) | 7557..7769 | - | 213 | WP_000687427.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261765 WP_000438827.1 NZ_CP107582:c5627-5340 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J8TIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |