Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3486307..3486960 | Replicon | chromosome |
Accession | NZ_CP107581 | ||
Organism | Acinetobacter baumannii strain 1326525-2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OIO86_RS16740 | Protein ID | WP_025467596.1 |
Coordinates | 3486307..3486696 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OIO86_RS16745 | Protein ID | WP_001288210.1 |
Coordinates | 3486703..3486960 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO86_RS16725 (OIO86_16730) | 3481425..3483620 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
OIO86_RS16730 (OIO86_16735) | 3483808..3484374 | - | 567 | WP_000651536.1 | rhombosortase | - |
OIO86_RS16735 (OIO86_16740) | 3484452..3485537 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
OIO86_RS16740 (OIO86_16745) | 3486307..3486696 | - | 390 | WP_025467596.1 | membrane protein | Toxin |
OIO86_RS16745 (OIO86_16750) | 3486703..3486960 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OIO86_RS16750 (OIO86_16755) | 3487148..3488320 | + | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
OIO86_RS16755 (OIO86_16760) | 3488369..3489859 | - | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OIO86_RS16760 (OIO86_16765) | 3490041..3490418 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OIO86_RS16765 (OIO86_16770) | 3490437..3491444 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T261763 WP_025467596.1 NZ_CP107581:c3486696-3486307 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|