Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 14028..14616 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107580 | ||
Organism | Acinetobacter baumannii strain 1326525-1 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
Locus tag | OIO53_RS19145 | Protein ID | WP_000438827.1 |
Coordinates | 14028..14315 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | OIO53_RS19150 | Protein ID | WP_001983304.1 |
Coordinates | 14302..14616 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO53_RS19120 (OIO53_19125) | 11886..12098 | + | 213 | WP_000687427.1 | hypothetical protein | - |
OIO53_RS19125 (OIO53_19130) | 12380..12556 | + | 177 | WP_000246872.1 | hypothetical protein | - |
OIO53_RS19130 (OIO53_19135) | 12592..13086 | + | 495 | WP_000999995.1 | hypothetical protein | - |
OIO53_RS19135 (OIO53_19140) | 13101..13385 | - | 285 | WP_001071102.1 | hypothetical protein | - |
OIO53_RS19140 (OIO53_19145) | 13479..13781 | + | 303 | WP_000702763.1 | hypothetical protein | - |
OIO53_RS19145 (OIO53_19150) | 14028..14315 | + | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
OIO53_RS19150 (OIO53_19155) | 14302..14616 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
OIO53_RS19155 (OIO53_19160) | 14744..17155 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
OIO53_RS19160 (OIO53_19165) | 17460..17921 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
OIO53_RS19165 (OIO53_19170) | 18247..18456 | - | 210 | WP_000069474.1 | hypothetical protein | - |
OIO53_RS19170 (OIO53_19175) | 18449..18751 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | - |
OIO53_RS19175 (OIO53_19180) | 18744..19100 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261762 WP_000438827.1 NZ_CP107580:14028-14315 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J8TIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |