Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 14036..14624 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107578 | ||
Organism | Acinetobacter baumannii strain 1326359 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
Locus tag | OIO45_RS19090 | Protein ID | WP_000438827.1 |
Coordinates | 14036..14323 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | OIO45_RS19095 | Protein ID | WP_001983304.1 |
Coordinates | 14310..14624 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO45_RS19065 (OIO45_19070) | 11894..12106 | + | 213 | WP_000687427.1 | hypothetical protein | - |
OIO45_RS19070 (OIO45_19075) | 12388..12564 | + | 177 | WP_000246872.1 | hypothetical protein | - |
OIO45_RS19075 (OIO45_19080) | 12600..13094 | + | 495 | WP_000999995.1 | hypothetical protein | - |
OIO45_RS19080 (OIO45_19085) | 13109..13393 | - | 285 | WP_001071102.1 | hypothetical protein | - |
OIO45_RS19085 (OIO45_19090) | 13487..13789 | + | 303 | WP_000702763.1 | hypothetical protein | - |
OIO45_RS19090 (OIO45_19095) | 14036..14323 | + | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
OIO45_RS19095 (OIO45_19100) | 14310..14624 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
OIO45_RS19100 (OIO45_19105) | 14752..17163 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
OIO45_RS19105 (OIO45_19110) | 17468..17929 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
OIO45_RS19110 (OIO45_19115) | 18255..18464 | - | 210 | WP_000069474.1 | hypothetical protein | - |
OIO45_RS19115 (OIO45_19120) | 18457..18759 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | - |
OIO45_RS19120 (OIO45_19125) | 18752..19108 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261760 WP_000438827.1 NZ_CP107578:14036-14323 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J8TIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |