Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 460301..460954 | Replicon | chromosome |
Accession | NZ_CP107577 | ||
Organism | Acinetobacter baumannii strain 1326359 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OIO45_RS02235 | Protein ID | WP_025467596.1 |
Coordinates | 460565..460954 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | OIO45_RS02230 | Protein ID | WP_001288210.1 |
Coordinates | 460301..460558 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO45_RS02210 (OIO45_02210) | 455817..456824 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
OIO45_RS02215 (OIO45_02215) | 456843..457220 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
OIO45_RS02220 (OIO45_02220) | 457402..458892 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
OIO45_RS02225 (OIO45_02225) | 458941..460113 | - | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
OIO45_RS02230 (OIO45_02230) | 460301..460558 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OIO45_RS02235 (OIO45_02235) | 460565..460954 | + | 390 | WP_025467596.1 | membrane protein | Toxin |
OIO45_RS02240 (OIO45_02240) | 461724..462809 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
OIO45_RS02245 (OIO45_02245) | 462887..463453 | + | 567 | WP_000651536.1 | rhombosortase | - |
OIO45_RS02250 (OIO45_02250) | 463641..465836 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T261759 WP_025467596.1 NZ_CP107577:460565-460954 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|