Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2250993..2251509 | Replicon | chromosome |
Accession | NZ_CP107576 | ||
Organism | Pseudomonas asiatica strain JP233 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F8G1E7 |
Locus tag | jpw_RS10465 | Protein ID | WP_003259987.1 |
Coordinates | 2251228..2251509 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | F8G1E6 |
Locus tag | jpw_RS10460 | Protein ID | WP_013972043.1 |
Coordinates | 2250993..2251238 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
jpw_RS10440 (jpw_10440) | 2246405..2246884 | - | 480 | WP_137137396.1 | transposase | - |
jpw_RS10445 (jpw_10445) | 2247141..2247683 | - | 543 | WP_015269935.1 | WYL domain-containing protein | - |
jpw_RS10450 (jpw_10450) | 2248419..2249612 | + | 1194 | WP_015269936.1 | MFS transporter | - |
jpw_RS10455 (jpw_10455) | 2249643..2250749 | + | 1107 | WP_054572951.1 | alkene reductase | - |
jpw_RS10460 (jpw_10460) | 2250993..2251238 | + | 246 | WP_013972043.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
jpw_RS10465 (jpw_10465) | 2251228..2251509 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
jpw_RS10470 (jpw_10470) | 2251525..2252157 | - | 633 | WP_015269938.1 | BRCT domain-containing protein | - |
jpw_RS10475 (jpw_10475) | 2252174..2252569 | - | 396 | WP_023662326.1 | hypothetical protein | - |
jpw_RS10480 (jpw_10480) | 2252658..2253566 | - | 909 | WP_013972045.1 | LysR family transcriptional regulator | - |
jpw_RS10485 (jpw_10485) | 2253858..2255162 | + | 1305 | WP_013972046.1 | MFS transporter | - |
jpw_RS10490 (jpw_10490) | 2255193..2256434 | + | 1242 | WP_015269941.1 | Zn-dependent hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T261756 WP_003259987.1 NZ_CP107576:2251228-2251509 [Pseudomonas asiatica]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|