Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 609125..609702 | Replicon | plasmid pJL.02bL |
| Accession | NZ_CP107574 | ||
| Organism | Pantoea dispersa strain JL.02bL | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OF384_RS22315 | Protein ID | WP_058781048.1 |
| Coordinates | 609370..609702 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A8E1V6C0 |
| Locus tag | OF384_RS22310 | Protein ID | WP_058770344.1 |
| Coordinates | 609125..609370 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF384_RS22290 (OF384_22290) | 604487..605440 | + | 954 | WP_264251862.1 | carbohydrate kinase family protein | - |
| OF384_RS22295 (OF384_22295) | 605444..606526 | + | 1083 | WP_058776100.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| OF384_RS22300 (OF384_22300) | 606646..608055 | - | 1410 | WP_058758997.1 | MFS transporter | - |
| OF384_RS22305 (OF384_22305) | 608171..609025 | + | 855 | WP_058770343.1 | helix-turn-helix transcriptional regulator | - |
| OF384_RS22310 (OF384_22310) | 609125..609370 | + | 246 | WP_058770344.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OF384_RS22315 (OF384_22315) | 609370..609702 | + | 333 | WP_058781048.1 | endoribonuclease MazF | Toxin |
| OF384_RS22320 (OF384_22320) | 609808..609981 | + | 174 | WP_021508895.1 | hypothetical protein | - |
| OF384_RS22325 (OF384_22325) | 610011..610358 | + | 348 | WP_021508894.1 | hypothetical protein | - |
| OF384_RS22330 (OF384_22330) | 610398..611591 | - | 1194 | WP_021508893.1 | zinc-dependent alcohol dehydrogenase | - |
| OF384_RS22335 (OF384_22335) | 611855..612562 | + | 708 | WP_021508892.1 | phage antirepressor KilAC domain-containing protein | - |
| OF384_RS22340 (OF384_22340) | 612597..612812 | - | 216 | WP_021508891.1 | hypothetical protein | - |
| OF384_RS22345 (OF384_22345) | 612954..614135 | - | 1182 | WP_264251863.1 | FAD-binding oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iroN | 1..696693 | 696693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11995.82 Da Isoelectric Point: 7.8855
>T261755 WP_058781048.1 NZ_CP107574:609370-609702 [Pantoea dispersa]
MVSRFVPDAGDLIWLDFDPTLGHEQGGHRPAVVLSPFAYNNKVGMLLCVPCTTQVKGYPFEVSLTGSRDSVALADQVTSI
DWRARKVVKKSHVTADELSEIRAKAKALIG
MVSRFVPDAGDLIWLDFDPTLGHEQGGHRPAVVLSPFAYNNKVGMLLCVPCTTQVKGYPFEVSLTGSRDSVALADQVTSI
DWRARKVVKKSHVTADELSEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|