Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 3939599..3940181 | Replicon | chromosome |
Accession | NZ_CP107573 | ||
Organism | Pantoea dispersa strain JL.02bL |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | OF384_RS18465 | Protein ID | WP_058771045.1 |
Coordinates | 3939882..3940181 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A8E1S1N8 |
Locus tag | OF384_RS18460 | Protein ID | WP_058775497.1 |
Coordinates | 3939599..3939901 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF384_RS18455 (OF384_18455) | 3936213..3939593 | + | 3381 | WP_264249816.1 | cellulose synthase complex outer membrane protein BcsC | - |
OF384_RS18460 (OF384_18460) | 3939599..3939901 | - | 303 | WP_058775497.1 | BrnA antitoxin family protein | Antitoxin |
OF384_RS18465 (OF384_18465) | 3939882..3940181 | - | 300 | WP_058771045.1 | BrnT family toxin | Toxin |
OF384_RS18470 (OF384_18470) | 3940405..3941409 | - | 1005 | WP_031279620.1 | glycosyl hydrolase family 8 | - |
OF384_RS18475 (OF384_18475) | 3941419..3941865 | - | 447 | WP_058758083.1 | cellulose biosynthesis protein BcsD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11919.36 Da Isoelectric Point: 6.9910
>T261750 WP_058771045.1 NZ_CP107573:c3940181-3939882 [Pantoea dispersa]
MQTEPEFEWDTTKAETNFRKHGIRFEVAARVFEDPFHLSVQDRYENGEYRWQTIGNVMGHVVILVAHTVRFETDVERIRI
ISARHATRIERRRYEQSQV
MQTEPEFEWDTTKAETNFRKHGIRFEVAARVFEDPFHLSVQDRYENGEYRWQTIGNVMGHVVILVAHTVRFETDVERIRI
ISARHATRIERRRYEQSQV
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|