Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3683234..3683933 | Replicon | chromosome |
Accession | NZ_CP107573 | ||
Organism | Pantoea dispersa strain JL.02bL |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OF384_RS17325 | Protein ID | WP_072208527.1 |
Coordinates | 3683757..3683933 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OF384_RS17320 | Protein ID | WP_058780883.1 |
Coordinates | 3683234..3683638 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF384_RS17305 (OF384_17305) | 3680403..3680642 | + | 240 | WP_264249640.1 | hypothetical protein | - |
OF384_RS17310 (OF384_17310) | 3680737..3682176 | - | 1440 | WP_264251751.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
OF384_RS17315 (OF384_17315) | 3682176..3683087 | - | 912 | WP_058780882.1 | N-acetylmuramic acid 6-phosphate etherase | - |
OF384_RS17320 (OF384_17320) | 3683234..3683638 | - | 405 | WP_058780883.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OF384_RS17325 (OF384_17325) | 3683757..3683933 | - | 177 | WP_072208527.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OF384_RS17330 (OF384_17330) | 3684109..3685410 | - | 1302 | WP_021507820.1 | glutamate/aspartate:proton symporter GltP | - |
OF384_RS17335 (OF384_17335) | 3685991..3687946 | + | 1956 | WP_264249644.1 | acetate--CoA ligase | - |
OF384_RS17340 (OF384_17340) | 3688120..3688449 | + | 330 | WP_021313201.1 | DUF485 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6824.11 Da Isoelectric Point: 10.6691
>T261749 WP_072208527.1 NZ_CP107573:c3683933-3683757 [Pantoea dispersa]
MSSRELIRMLLERGWILDRVKGSHHVFVRADKPYHISLPHPEKDLATGTLRKLLKMMD
MSSRELIRMLLERGWILDRVKGSHHVFVRADKPYHISLPHPEKDLATGTLRKLLKMMD
Download Length: 177 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14641.36 Da Isoelectric Point: 4.9322
>AT261749 WP_058780883.1 NZ_CP107573:c3683638-3683234 [Pantoea dispersa]
MRFPVYLHKTENGSWSGFVPDVQGCFFAGNTVDEALSDAFGAIDAHVESLADAGKAIPKAASVETHINDEECQGGYWAFV
EIDLSRYEGKAVKLNITLPQNLLSKIDSHVEAHREYGSRSGFLAALARRELANI
MRFPVYLHKTENGSWSGFVPDVQGCFFAGNTVDEALSDAFGAIDAHVESLADAGKAIPKAASVETHINDEECQGGYWAFV
EIDLSRYEGKAVKLNITLPQNLLSKIDSHVEAHREYGSRSGFLAALARRELANI
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|