Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3064500..3065120 | Replicon | chromosome |
| Accession | NZ_CP107573 | ||
| Organism | Pantoea dispersa strain JL.02bL | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A246NIG6 |
| Locus tag | OF384_RS14525 | Protein ID | WP_021507203.1 |
| Coordinates | 3064902..3065120 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A246NI99 |
| Locus tag | OF384_RS14520 | Protein ID | WP_021313568.1 |
| Coordinates | 3064500..3064877 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF384_RS14490 (OF384_14490) | 3060824..3061081 | + | 258 | WP_021507208.1 | type B 50S ribosomal protein L31 | - |
| OF384_RS14495 (OF384_14495) | 3061097..3061237 | + | 141 | WP_010616859.1 | type B 50S ribosomal protein L36 | - |
| OF384_RS14500 (OF384_14500) | 3061282..3062160 | - | 879 | WP_264249209.1 | metal ABC transporter substrate-binding protein | - |
| OF384_RS14505 (OF384_14505) | 3062182..3063021 | - | 840 | WP_021507206.1 | metal ABC transporter permease | - |
| OF384_RS14510 (OF384_14510) | 3063018..3063674 | - | 657 | WP_021507205.1 | ABC transporter ATP-binding protein | - |
| OF384_RS14515 (OF384_14515) | 3064002..3064354 | + | 353 | Protein_2826 | hypothetical protein | - |
| OF384_RS14520 (OF384_14520) | 3064500..3064877 | + | 378 | WP_021313568.1 | Hha toxicity modulator TomB | Antitoxin |
| OF384_RS14525 (OF384_14525) | 3064902..3065120 | + | 219 | WP_021507203.1 | HHA domain-containing protein | Toxin |
| OF384_RS14535 (OF384_14535) | 3065522..3065833 | + | 312 | WP_021507202.1 | MGMT family protein | - |
| OF384_RS14540 (OF384_14540) | 3066001..3066558 | - | 558 | WP_021507201.1 | YbaY family lipoprotein | - |
| OF384_RS14545 (OF384_14545) | 3066762..3067625 | + | 864 | WP_058757950.1 | acyl-CoA thioesterase II | - |
| OF384_RS14550 (OF384_14550) | 3067698..3068987 | - | 1290 | WP_264249213.1 | ammonium transporter AmtB | - |
| OF384_RS14555 (OF384_14555) | 3069021..3069359 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8538.87 Da Isoelectric Point: 8.8662
>T261747 WP_021507203.1 NZ_CP107573:3064902-3065120 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR
Download Length: 219 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14665.34 Da Isoelectric Point: 4.4796
>AT261747 WP_021313568.1 NZ_CP107573:3064500-3064877 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NIG6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NI99 |