Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3064500..3065120 Replicon chromosome
Accession NZ_CP107573
Organism Pantoea dispersa strain JL.02bL

Toxin (Protein)


Gene name Hha Uniprot ID A0A246NIG6
Locus tag OF384_RS14525 Protein ID WP_021507203.1
Coordinates 3064902..3065120 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A246NI99
Locus tag OF384_RS14520 Protein ID WP_021313568.1
Coordinates 3064500..3064877 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF384_RS14490 (OF384_14490) 3060824..3061081 + 258 WP_021507208.1 type B 50S ribosomal protein L31 -
OF384_RS14495 (OF384_14495) 3061097..3061237 + 141 WP_010616859.1 type B 50S ribosomal protein L36 -
OF384_RS14500 (OF384_14500) 3061282..3062160 - 879 WP_264249209.1 metal ABC transporter substrate-binding protein -
OF384_RS14505 (OF384_14505) 3062182..3063021 - 840 WP_021507206.1 metal ABC transporter permease -
OF384_RS14510 (OF384_14510) 3063018..3063674 - 657 WP_021507205.1 ABC transporter ATP-binding protein -
OF384_RS14515 (OF384_14515) 3064002..3064354 + 353 Protein_2826 hypothetical protein -
OF384_RS14520 (OF384_14520) 3064500..3064877 + 378 WP_021313568.1 Hha toxicity modulator TomB Antitoxin
OF384_RS14525 (OF384_14525) 3064902..3065120 + 219 WP_021507203.1 HHA domain-containing protein Toxin
OF384_RS14535 (OF384_14535) 3065522..3065833 + 312 WP_021507202.1 MGMT family protein -
OF384_RS14540 (OF384_14540) 3066001..3066558 - 558 WP_021507201.1 YbaY family lipoprotein -
OF384_RS14545 (OF384_14545) 3066762..3067625 + 864 WP_058757950.1 acyl-CoA thioesterase II -
OF384_RS14550 (OF384_14550) 3067698..3068987 - 1290 WP_264249213.1 ammonium transporter AmtB -
OF384_RS14555 (OF384_14555) 3069021..3069359 - 339 WP_007886947.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8538.87 Da        Isoelectric Point: 8.8662

>T261747 WP_021507203.1 NZ_CP107573:3064902-3065120 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14665.34 Da        Isoelectric Point: 4.4796

>AT261747 WP_021313568.1 NZ_CP107573:3064500-3064877 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246NIG6

Antitoxin

Source ID Structure
AlphaFold DB A0A246NI99

References