Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2473462..2474076 | Replicon | chromosome |
| Accession | NZ_CP107573 | ||
| Organism | Pantoea dispersa strain JL.02bL | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OF384_RS11610 | Protein ID | WP_132462912.1 |
| Coordinates | 2473462..2473644 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OF384_RS11615 | Protein ID | WP_136547706.1 |
| Coordinates | 2473684..2474076 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF384_RS11555 (OF384_11555) | 2468604..2469266 | + | 663 | WP_260641332.1 | MBL fold metallo-hydrolase | - |
| OF384_RS11560 (OF384_11560) | 2469267..2469680 | - | 414 | WP_058757613.1 | GNAT family N-acetyltransferase | - |
| OF384_RS11565 (OF384_11565) | 2469702..2470085 | - | 384 | WP_058780734.1 | hypothetical protein | - |
| OF384_RS11570 (OF384_11570) | 2470305..2470661 | + | 357 | WP_010617204.1 | DUF4186 domain-containing protein | - |
| OF384_RS11575 (OF384_11575) | 2470680..2470859 | - | 180 | WP_031279245.1 | hypothetical protein | - |
| OF384_RS11580 (OF384_11580) | 2471063..2471392 | + | 330 | WP_222951040.1 | hypothetical protein | - |
| OF384_RS11585 (OF384_11585) | 2471454..2472002 | + | 549 | WP_264248558.1 | hypothetical protein | - |
| OF384_RS11590 (OF384_11590) | 2472027..2472233 | - | 207 | WP_058769647.1 | DUF2767 family protein | - |
| OF384_RS11595 (OF384_11595) | 2472414..2472662 | + | 249 | WP_021506368.1 | DUF883 family protein | - |
| OF384_RS11600 (OF384_11600) | 2472698..2472895 | - | 198 | WP_166718691.1 | hypothetical protein | - |
| OF384_RS11605 (OF384_11605) | 2472996..2473193 | - | 198 | WP_021506369.1 | DUF6404 family protein | - |
| OF384_RS11610 (OF384_11610) | 2473462..2473644 | + | 183 | WP_132462912.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OF384_RS11615 (OF384_11615) | 2473684..2474076 | + | 393 | WP_136547706.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OF384_RS11620 (OF384_11620) | 2474161..2475417 | + | 1257 | WP_021506372.1 | mechanosensitive ion channel | - |
| OF384_RS11625 (OF384_11625) | 2475540..2476790 | - | 1251 | WP_010617214.1 | NADP-dependent isocitrate dehydrogenase | - |
| OF384_RS11630 (OF384_11630) | 2476892..2477560 | + | 669 | WP_150058306.1 | 23S rRNA pseudouridine(2457) synthase RluE | - |
| OF384_RS11635 (OF384_11635) | 2477605..2478078 | + | 474 | WP_264248571.1 | NUDIX hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6944.16 Da Isoelectric Point: 10.9062
>T261746 WP_132462912.1 NZ_CP107573:2473462-2473644 [Pantoea dispersa]
MKSATLIKVLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
MKSATLIKVLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14568.51 Da Isoelectric Point: 4.8732
>AT261746 WP_136547706.1 NZ_CP107573:2473684-2474076 [Pantoea dispersa]
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALLS
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALLS
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|