Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2473462..2474076 Replicon chromosome
Accession NZ_CP107573
Organism Pantoea dispersa strain JL.02bL

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OF384_RS11610 Protein ID WP_132462912.1
Coordinates 2473462..2473644 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OF384_RS11615 Protein ID WP_136547706.1
Coordinates 2473684..2474076 (+) Length 131 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF384_RS11555 (OF384_11555) 2468604..2469266 + 663 WP_260641332.1 MBL fold metallo-hydrolase -
OF384_RS11560 (OF384_11560) 2469267..2469680 - 414 WP_058757613.1 GNAT family N-acetyltransferase -
OF384_RS11565 (OF384_11565) 2469702..2470085 - 384 WP_058780734.1 hypothetical protein -
OF384_RS11570 (OF384_11570) 2470305..2470661 + 357 WP_010617204.1 DUF4186 domain-containing protein -
OF384_RS11575 (OF384_11575) 2470680..2470859 - 180 WP_031279245.1 hypothetical protein -
OF384_RS11580 (OF384_11580) 2471063..2471392 + 330 WP_222951040.1 hypothetical protein -
OF384_RS11585 (OF384_11585) 2471454..2472002 + 549 WP_264248558.1 hypothetical protein -
OF384_RS11590 (OF384_11590) 2472027..2472233 - 207 WP_058769647.1 DUF2767 family protein -
OF384_RS11595 (OF384_11595) 2472414..2472662 + 249 WP_021506368.1 DUF883 family protein -
OF384_RS11600 (OF384_11600) 2472698..2472895 - 198 WP_166718691.1 hypothetical protein -
OF384_RS11605 (OF384_11605) 2472996..2473193 - 198 WP_021506369.1 DUF6404 family protein -
OF384_RS11610 (OF384_11610) 2473462..2473644 + 183 WP_132462912.1 type II toxin-antitoxin system HicA family toxin Toxin
OF384_RS11615 (OF384_11615) 2473684..2474076 + 393 WP_136547706.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OF384_RS11620 (OF384_11620) 2474161..2475417 + 1257 WP_021506372.1 mechanosensitive ion channel -
OF384_RS11625 (OF384_11625) 2475540..2476790 - 1251 WP_010617214.1 NADP-dependent isocitrate dehydrogenase -
OF384_RS11630 (OF384_11630) 2476892..2477560 + 669 WP_150058306.1 23S rRNA pseudouridine(2457) synthase RluE -
OF384_RS11635 (OF384_11635) 2477605..2478078 + 474 WP_264248571.1 NUDIX hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-124)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6944.16 Da        Isoelectric Point: 10.9062

>T261746 WP_132462912.1 NZ_CP107573:2473462-2473644 [Pantoea dispersa]
MKSATLIKVLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD

Download         Length: 183 bp

Antitoxin


Download         Length: 131 a.a.        Molecular weight: 14568.51 Da        Isoelectric Point: 4.8732

>AT261746 WP_136547706.1 NZ_CP107573:2473684-2474076 [Pantoea dispersa]
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALLS

Download         Length: 393 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References