Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1636909..1637526 | Replicon | chromosome |
| Accession | NZ_CP107573 | ||
| Organism | Pantoea dispersa strain JL.02bL | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8E1RWX8 |
| Locus tag | OF384_RS07465 | Protein ID | WP_058771102.1 |
| Coordinates | 1636909..1637097 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OF384_RS07470 | Protein ID | WP_058781997.1 |
| Coordinates | 1637116..1637526 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF384_RS07450 (OF384_07450) | 1633799..1634584 | - | 786 | WP_264251495.1 | PhnD/SsuA/transferrin family substrate-binding protein | - |
| OF384_RS07455 (OF384_07455) | 1634481..1635548 | - | 1068 | WP_264251497.1 | fatty acid desaturase | - |
| OF384_RS07460 (OF384_07460) | 1635766..1636788 | + | 1023 | WP_264251500.1 | LLM class flavin-dependent oxidoreductase | - |
| OF384_RS07465 (OF384_07465) | 1636909..1637097 | + | 189 | WP_058771102.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OF384_RS07470 (OF384_07470) | 1637116..1637526 | + | 411 | WP_058781997.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OF384_RS07475 (OF384_07475) | 1637790..1638617 | - | 828 | WP_058771104.1 | glycosyltransferase family 8 protein | - |
| OF384_RS07480 (OF384_07480) | 1638636..1640018 | - | 1383 | WP_264251504.1 | D-arabinono-1,4-lactone oxidase | - |
| OF384_RS07485 (OF384_07485) | 1640097..1640738 | - | 642 | WP_021509768.1 | TetR family transcriptional regulator | - |
| OF384_RS07490 (OF384_07490) | 1640951..1641778 | + | 828 | WP_088518052.1 | MetQ/NlpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7028.26 Da Isoelectric Point: 11.1475
>T261745 WP_058771102.1 NZ_CP107573:1636909-1637097 [Pantoea dispersa]
MDSRSLMAEIRADGWELIRINGSHHHFVHPTKKGLVTIPHPKKDLPIKTVKSIRKQAGLTVH
MDSRSLMAEIRADGWELIRINGSHHHFVHPTKKGLVTIPHPKKDLPIKTVKSIRKQAGLTVH
Download Length: 189 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14780.06 Da Isoelectric Point: 4.6268
>AT261745 WP_058781997.1 NZ_CP107573:1637116-1637526 [Pantoea dispersa]
MFYPIAIEAGDETTAYGVTVPDLPGCFSAGDTLEEAVKNAKEAITGHLELMVELGQDIPAVSDLKSLMKSAEFAGYVWVL
VDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTR
MFYPIAIEAGDETTAYGVTVPDLPGCFSAGDTLEEAVKNAKEAITGHLELMVELGQDIPAVSDLKSLMKSAEFAGYVWVL
VDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|