Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
| Location | 2921121..2921686 | Replicon | chromosome |
| Accession | NZ_CP107567 | ||
| Organism | Streptomyces peucetius strain NA0869 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | OGH68_RS13340 | Protein ID | WP_264243761.1 |
| Coordinates | 2921121..2921489 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | OGH68_RS13345 | Protein ID | WP_159691605.1 |
| Coordinates | 2921489..2921686 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGH68_RS13325 (OGH68_13325) | 2916614..2917402 | - | 789 | WP_264243755.1 | S16 family serine protease | - |
| OGH68_RS13330 (OGH68_13330) | 2918261..2918902 | - | 642 | WP_264243757.1 | helix-turn-helix domain-containing protein | - |
| OGH68_RS13335 (OGH68_13335) | 2919179..2920963 | - | 1785 | WP_264243759.1 | DEAD/DEAH box helicase | - |
| OGH68_RS13340 (OGH68_13340) | 2921121..2921489 | - | 369 | WP_264243761.1 | Fic family protein | Toxin |
| OGH68_RS13345 (OGH68_13345) | 2921489..2921686 | - | 198 | WP_159691605.1 | Arc family DNA-binding protein | Antitoxin |
| OGH68_RS13350 (OGH68_13350) | 2921720..2923186 | - | 1467 | WP_264243763.1 | MFS transporter | - |
| OGH68_RS13355 (OGH68_13355) | 2923486..2923845 | + | 360 | WP_264243765.1 | hypothetical protein | - |
| OGH68_RS13360 (OGH68_13360) | 2923865..2926159 | + | 2295 | WP_264243767.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13743.66 Da Isoelectric Point: 4.8500
>T261743 WP_264243761.1 NZ_CP107567:c2921489-2921121 [Streptomyces peucetius]
MNYLTLPELLKLAERLGAEEVRDYGLLDSALARPQSSVFGQDAYPDIWQKAAALMESLARNHALVDGNKRIAWYATWVFL
HMNGHRLSPGFDVDEAEQFVLNVCQGLLDVPKTAEQLPRFAQ
MNYLTLPELLKLAERLGAEEVRDYGLLDSALARPQSSVFGQDAYPDIWQKAAALMESLARNHALVDGNKRIAWYATWVFL
HMNGHRLSPGFDVDEAEQFVLNVCQGLLDVPKTAEQLPRFAQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|