Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 86259..86899 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107559 | ||
| Organism | Methylocystis sp. MJC1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OGR47_RS19290 | Protein ID | WP_165056051.1 |
| Coordinates | 86492..86899 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OGR47_RS19285 | Protein ID | WP_165056049.1 |
| Coordinates | 86259..86495 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGR47_RS19260 (OGR47_19260) | 81387..81584 | - | 198 | WP_165056042.1 | type II toxin-antitoxin system VapC family toxin | - |
| OGR47_RS19265 (OGR47_19265) | 81789..81998 | - | 210 | WP_256367655.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| OGR47_RS19270 (OGR47_19270) | 82032..83369 | - | 1338 | WP_165056044.1 | plasmid replication protein RepC | - |
| OGR47_RS19275 (OGR47_19275) | 83541..84557 | - | 1017 | WP_165056045.1 | plasmid partitioning protein RepB | - |
| OGR47_RS19280 (OGR47_19280) | 84554..85762 | - | 1209 | WP_165056047.1 | plasmid partitioning protein RepA | - |
| OGR47_RS19285 (OGR47_19285) | 86259..86495 | + | 237 | WP_165056049.1 | antitoxin | Antitoxin |
| OGR47_RS19290 (OGR47_19290) | 86492..86899 | + | 408 | WP_165056051.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OGR47_RS19295 (OGR47_19295) | 87331..88500 | - | 1170 | WP_165056053.1 | glycosyltransferase family 4 protein | - |
| OGR47_RS19300 (OGR47_19300) | 88667..90787 | - | 2121 | WP_165056054.1 | polysaccharide biosynthesis tyrosine autokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..353861 | 353861 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14599.81 Da Isoelectric Point: 5.7560
>T261742 WP_165056051.1 NZ_CP107559:86492-86899 [Methylocystis sp. MJC1]
MTRYLLDTNIISDLIRRPSGAVASHIARVGEKNVCTSIIVAAELRYGCAKNSSKRLLQAVESLLGELDVLSLEEPVDMEY
GRIRAQLEQKGSPIGGNDLLIAAHALAVDATIVTANVNEFARVEGLKVENWLAAK
MTRYLLDTNIISDLIRRPSGAVASHIARVGEKNVCTSIIVAAELRYGCAKNSSKRLLQAVESLLGELDVLSLEEPVDMEY
GRIRAQLEQKGSPIGGNDLLIAAHALAVDATIVTANVNEFARVEGLKVENWLAAK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|