Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prcAT/RES-TIGR02293 |
| Location | 78843..79705 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107559 | ||
| Organism | Methylocystis sp. MJC1 | ||
Toxin (Protein)
| Gene name | PrcT | Uniprot ID | - |
| Locus tag | OGR47_RS19240 | Protein ID | WP_165056040.1 |
| Coordinates | 78843..79277 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | PrcA | Uniprot ID | - |
| Locus tag | OGR47_RS19245 | Protein ID | WP_165056041.1 |
| Coordinates | 79277..79705 (-) | Length | 143 a.a. |
Genomic Context
Location: 78592..78792 (201 bp)
Type: Others
Protein ID: Protein_81
Type: Others
Protein ID: Protein_81
Location: 79788..79934 (147 bp)
Type: Others
Protein ID: Protein_84
Type: Others
Protein ID: Protein_84
Location: 80225..81352 (1128 bp)
Type: Others
Protein ID: WP_165056061.1
Type: Others
Protein ID: WP_165056061.1
Location: 74967..76010 (1044 bp)
Type: Others
Protein ID: WP_216697968.1
Type: Others
Protein ID: WP_216697968.1
Location: 76007..76888 (882 bp)
Type: Others
Protein ID: WP_165056331.1
Type: Others
Protein ID: WP_165056331.1
Location: 76881..78392 (1512 bp)
Type: Others
Protein ID: WP_165056332.1
Type: Others
Protein ID: WP_165056332.1
Location: 78843..79277 (435 bp)
Type: Toxin
Protein ID: WP_165056040.1
Type: Toxin
Protein ID: WP_165056040.1
Location: 79277..79705 (429 bp)
Type: Antitoxin
Protein ID: WP_165056041.1
Type: Antitoxin
Protein ID: WP_165056041.1
Location: 81387..81584 (198 bp)
Type: Others
Protein ID: WP_165056042.1
Type: Others
Protein ID: WP_165056042.1
Location: 81789..81998 (210 bp)
Type: Others
Protein ID: WP_256367655.1
Type: Others
Protein ID: WP_256367655.1
Location: 82032..83369 (1338 bp)
Type: Others
Protein ID: WP_165056044.1
Type: Others
Protein ID: WP_165056044.1
Location: 83541..84557 (1017 bp)
Type: Others
Protein ID: WP_165056045.1
Type: Others
Protein ID: WP_165056045.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGR47_RS19220 (OGR47_19220) | 74967..76010 | - | 1044 | WP_216697968.1 | TniQ family protein | - |
| OGR47_RS19225 (OGR47_19225) | 76007..76888 | - | 882 | WP_165056331.1 | TniB family NTP-binding protein | - |
| OGR47_RS19230 (OGR47_19230) | 76881..78392 | - | 1512 | WP_165056332.1 | Mu transposase C-terminal domain-containing protein | - |
| OGR47_RS19235 (OGR47_19235) | 78592..78792 | + | 201 | Protein_81 | integrase | - |
| OGR47_RS19240 (OGR47_19240) | 78843..79277 | - | 435 | WP_165056040.1 | RES family NAD+ phosphorylase | Toxin |
| OGR47_RS19245 (OGR47_19245) | 79277..79705 | - | 429 | WP_165056041.1 | DUF2384 domain-containing protein | Antitoxin |
| OGR47_RS19250 (OGR47_19250) | 79788..79934 | + | 147 | Protein_84 | VapC toxin family PIN domain ribonuclease | - |
| OGR47_RS19255 (OGR47_19255) | 80225..81352 | + | 1128 | WP_165056061.1 | tyrosine-type recombinase/integrase | - |
| OGR47_RS19260 (OGR47_19260) | 81387..81584 | - | 198 | WP_165056042.1 | type II toxin-antitoxin system VapC family toxin | - |
| OGR47_RS19265 (OGR47_19265) | 81789..81998 | - | 210 | WP_256367655.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| OGR47_RS19270 (OGR47_19270) | 82032..83369 | - | 1338 | WP_165056044.1 | plasmid replication protein RepC | - |
| OGR47_RS19275 (OGR47_19275) | 83541..84557 | - | 1017 | WP_165056045.1 | plasmid partitioning protein RepB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..353861 | 353861 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15889.22 Da Isoelectric Point: 5.1687
>T261741 WP_165056040.1 NZ_CP107559:c79277-78843 [Methylocystis sp. MJC1]
MNVWRICRKPFADLSGDGARLHGGRWNSPGWPVVYTAETAALAVLEVRVHLDLDWTVLPDDYVLMEINLPGDLSREEIRD
IPPDPIAIGDSWLAAGASALLKVPSFIIPESANILINVAHPSAARAATAAIRPFSFDERLWRPR
MNVWRICRKPFADLSGDGARLHGGRWNSPGWPVVYTAETAALAVLEVRVHLDLDWTVLPDDYVLMEINLPGDLSREEIRD
IPPDPIAIGDSWLAAGASALLKVPSFIIPESANILINVAHPSAARAATAAIRPFSFDERLWRPR
Download Length: 435 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15365.51 Da Isoelectric Point: 10.2525
>AT261741 WP_165056041.1 NZ_CP107559:c79705-79277 [Methylocystis sp. MJC1]
MSGGNALDFAKVGAILEIGATDSREAAEATRRGLPVAALDEIVKSGRLTPTEVDRIVLPRKTLAHRRKIGTLTPDQSDRL
IRVARVIAVAETTFGSKEKASRWLRRPTTAFDGDAPISLLDTSEGSRQVEHFLARIDYGLAA
MSGGNALDFAKVGAILEIGATDSREAAEATRRGLPVAALDEIVKSGRLTPTEVDRIVLPRKTLAHRRKIGTLTPDQSDRL
IRVARVIAVAETTFGSKEKASRWLRRPTTAFDGDAPISLLDTSEGSRQVEHFLARIDYGLAA
Download Length: 429 bp