Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 3368868..3369459 | Replicon | chromosome |
| Accession | NZ_CP107558 | ||
| Organism | Methylocystis sp. MJC1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | OGR47_RS16200 | Protein ID | WP_165055102.1 |
| Coordinates | 3369127..3369459 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | OGR47_RS16195 | Protein ID | WP_165055104.1 |
| Coordinates | 3368868..3369125 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGR47_RS16170 (OGR47_16170) | 3364360..3364608 | + | 249 | WP_165055109.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OGR47_RS16175 (OGR47_16175) | 3364575..3364988 | + | 414 | WP_246729810.1 | type II toxin-antitoxin system VapC family toxin | - |
| OGR47_RS16180 (OGR47_16180) | 3365103..3365750 | + | 648 | WP_165055108.1 | preprotein translocase subunit SecG | - |
| OGR47_RS16185 (OGR47_16185) | 3365861..3367489 | + | 1629 | WP_165055106.1 | CTP synthase | - |
| OGR47_RS16190 (OGR47_16190) | 3368335..3368799 | + | 465 | WP_165055105.1 | diadenylate cyclase | - |
| OGR47_RS16195 (OGR47_16195) | 3368868..3369125 | + | 258 | WP_165055104.1 | antitoxin | Antitoxin |
| OGR47_RS16200 (OGR47_16200) | 3369127..3369459 | + | 333 | WP_165055102.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OGR47_RS16205 (OGR47_16205) | 3369487..3369711 | - | 225 | WP_246729813.1 | ribbon-helix-helix domain-containing protein | - |
| OGR47_RS16210 (OGR47_16210) | 3369789..3369971 | - | 183 | WP_165055099.1 | DUF4169 family protein | - |
| OGR47_RS16215 (OGR47_16215) | 3369971..3370537 | - | 567 | WP_165055097.1 | ClpXP protease specificity-enhancing factor SspB | - |
| OGR47_RS16225 (OGR47_16225) | 3371237..3372121 | + | 885 | WP_165055096.1 | succinate--CoA ligase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11630.43 Da Isoelectric Point: 7.8642
>T261739 WP_165055102.1 NZ_CP107558:3369127-3369459 [Methylocystis sp. MJC1]
MERGDIYLVSLDPTSGHEQRGARPVLIVSATAFNKITKTPIVLPITSGGNFARTAGFAVSLMGAGTQTTGVIRCDQPRAL
DLGARHARKLECAPPEIVDEALAKLAAIFE
MERGDIYLVSLDPTSGHEQRGARPVLIVSATAFNKITKTPIVLPITSGGNFARTAGFAVSLMGAGTQTTGVIRCDQPRAL
DLGARHARKLECAPPEIVDEALAKLAAIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|