Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3544644..3545561 | Replicon | chromosome |
Accession | NZ_CP107557 | ||
Organism | Bacillus velezensis strain CPA1-1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | OGL87_RS17375 | Protein ID | WP_007407256.1 |
Coordinates | 3544644..3545390 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | OGL87_RS17380 | Protein ID | WP_003154807.1 |
Coordinates | 3545391..3545561 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGL87_RS17355 (OGL87_17355) | 3540037..3540987 | - | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
OGL87_RS17360 (OGL87_17360) | 3541309..3542625 | + | 1317 | WP_032874616.1 | amino acid permease | - |
OGL87_RS17365 (OGL87_17365) | 3542911..3543528 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
OGL87_RS17370 (OGL87_17370) | 3543541..3544539 | + | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
OGL87_RS17375 (OGL87_17375) | 3544644..3545390 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OGL87_RS17380 (OGL87_17380) | 3545391..3545561 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OGL87_RS17385 (OGL87_17385) | 3545658..3545783 | + | 126 | WP_003154809.1 | hypothetical protein | - |
OGL87_RS17390 (OGL87_17390) | 3545818..3546696 | - | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
OGL87_RS17395 (OGL87_17395) | 3546710..3546973 | - | 264 | WP_003154813.1 | phage holin | - |
OGL87_RS17400 (OGL87_17400) | 3546987..3547250 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
OGL87_RS17405 (OGL87_17405) | 3547302..3548063 | - | 762 | WP_032874607.1 | hypothetical protein | - |
OGL87_RS17410 (OGL87_17410) | 3548120..3548317 | - | 198 | WP_032874605.1 | XkdX family protein | - |
OGL87_RS17415 (OGL87_17415) | 3548322..3548693 | - | 372 | WP_032874603.1 | XkdW family protein | - |
OGL87_RS17420 (OGL87_17420) | 3548706..3550328 | - | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T261736 WP_007407256.1 NZ_CP107557:3544644-3545390 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|