Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 366609..367246 | Replicon | chromosome |
Accession | NZ_CP107557 | ||
Organism | Bacillus velezensis strain CPA1-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OGL87_RS01865 | Protein ID | WP_003156187.1 |
Coordinates | 366609..366959 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | OGL87_RS01870 | Protein ID | WP_003156188.1 |
Coordinates | 366965..367246 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGL87_RS01825 (OGL87_01825) | 361649..362251 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
OGL87_RS01830 (OGL87_01830) | 362251..363039 | - | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
OGL87_RS01835 (OGL87_01835) | 363005..363487 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
OGL87_RS01840 (OGL87_01840) | 363484..363813 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
OGL87_RS01845 (OGL87_01845) | 363877..364884 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
OGL87_RS01850 (OGL87_01850) | 364896..365297 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
OGL87_RS01855 (OGL87_01855) | 365300..365665 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
OGL87_RS01860 (OGL87_01860) | 365670..366491 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
OGL87_RS01865 (OGL87_01865) | 366609..366959 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OGL87_RS01870 (OGL87_01870) | 366965..367246 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OGL87_RS01875 (OGL87_01875) | 367366..368535 | - | 1170 | WP_032873001.1 | alanine racemase | - |
OGL87_RS01880 (OGL87_01880) | 368652..369659 | - | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
OGL87_RS01885 (OGL87_01885) | 369824..370189 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
OGL87_RS01890 (OGL87_01890) | 370282..370881 | + | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T261735 WP_003156187.1 NZ_CP107557:c366959-366609 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|