Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1218117..1219034 | Replicon | chromosome |
Accession | NZ_CP107556 | ||
Organism | Bacillus velezensis strain Bacillus velezensis F3A |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | OF857_RS06475 | Protein ID | WP_057079950.1 |
Coordinates | 1218288..1219034 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | OF857_RS06470 | Protein ID | WP_003154807.1 |
Coordinates | 1218117..1218287 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF857_RS06430 (OF857_06430) | 1213350..1214972 | + | 1623 | WP_166706517.1 | pyocin knob domain-containing protein | - |
OF857_RS06435 (OF857_06435) | 1214985..1215356 | + | 372 | WP_070081681.1 | XkdW family protein | - |
OF857_RS06440 (OF857_06440) | 1215361..1215558 | + | 198 | WP_168237133.1 | XkdX family protein | - |
OF857_RS06445 (OF857_06445) | 1215615..1216376 | + | 762 | WP_070081683.1 | phage portal protein | - |
OF857_RS06450 (OF857_06450) | 1216428..1216691 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
OF857_RS06455 (OF857_06455) | 1216705..1216968 | + | 264 | WP_003154813.1 | phage holin | - |
OF857_RS06460 (OF857_06460) | 1216982..1217860 | + | 879 | WP_264101516.1 | N-acetylmuramoyl-L-alanine amidase | - |
OF857_RS06465 (OF857_06465) | 1217895..1218020 | - | 126 | WP_003154809.1 | hypothetical protein | - |
OF857_RS06470 (OF857_06470) | 1218117..1218287 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OF857_RS06475 (OF857_06475) | 1218288..1219034 | - | 747 | WP_057079950.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OF857_RS06480 (OF857_06480) | 1219139..1220137 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
OF857_RS06485 (OF857_06485) | 1220150..1220767 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
OF857_RS06490 (OF857_06490) | 1221054..1222370 | - | 1317 | WP_003154801.1 | amino acid permease | - |
OF857_RS06495 (OF857_06495) | 1222693..1223643 | + | 951 | WP_039251754.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29033.52 Da Isoelectric Point: 4.7755
>T261734 WP_057079950.1 NZ_CP107556:c1219034-1218288 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|