Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 489186..489823 | Replicon | chromosome |
Accession | NZ_CP107556 | ||
Organism | Bacillus velezensis strain Bacillus velezensis F3A |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OF857_RS02535 | Protein ID | WP_003156187.1 |
Coordinates | 489473..489823 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | OF857_RS02530 | Protein ID | WP_003156188.1 |
Coordinates | 489186..489467 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF857_RS02510 (OF857_02510) | 485551..486150 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
OF857_RS02515 (OF857_02515) | 486243..486608 | + | 366 | WP_070081400.1 | holo-ACP synthase | - |
OF857_RS02520 (OF857_02520) | 486773..487780 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
OF857_RS02525 (OF857_02525) | 487897..489066 | + | 1170 | WP_128574472.1 | alanine racemase | - |
OF857_RS02530 (OF857_02530) | 489186..489467 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OF857_RS02535 (OF857_02535) | 489473..489823 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OF857_RS02540 (OF857_02540) | 489941..490762 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
OF857_RS02545 (OF857_02545) | 490767..491132 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
OF857_RS02550 (OF857_02550) | 491135..491536 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
OF857_RS02555 (OF857_02555) | 491548..492555 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
OF857_RS02560 (OF857_02560) | 492618..492947 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
OF857_RS02565 (OF857_02565) | 492944..493426 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
OF857_RS02570 (OF857_02570) | 493392..494180 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
OF857_RS02575 (OF857_02575) | 494180..494782 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T261733 WP_003156187.1 NZ_CP107556:489473-489823 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|