Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2744471..2745078 | Replicon | chromosome |
| Accession | NZ_CP107548 | ||
| Organism | Pusillimonas sp. M17 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OEG81_RS12925 | Protein ID | WP_264129663.1 |
| Coordinates | 2744782..2745078 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OEG81_RS12920 | Protein ID | WP_264129662.1 |
| Coordinates | 2744471..2744776 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG81_RS12900 (OEG81_12900) | 2740368..2741339 | - | 972 | WP_264129659.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| OEG81_RS12905 (OEG81_12905) | 2741378..2742106 | - | 729 | WP_264129660.1 | GntR family transcriptional regulator | - |
| OEG81_RS12910 (OEG81_12910) | 2742192..2743529 | - | 1338 | WP_264129661.1 | chloride channel protein | - |
| OEG81_RS12915 (OEG81_12915) | 2743812..2744447 | + | 636 | WP_264132595.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| OEG81_RS12920 (OEG81_12920) | 2744471..2744776 | - | 306 | WP_264129662.1 | putative addiction module antidote protein | Antitoxin |
| OEG81_RS12925 (OEG81_12925) | 2744782..2745078 | - | 297 | WP_264129663.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OEG81_RS12930 (OEG81_12930) | 2745265..2746521 | - | 1257 | WP_264129664.1 | NADP-dependent isocitrate dehydrogenase | - |
| OEG81_RS12935 (OEG81_12935) | 2746714..2747142 | + | 429 | WP_264129665.1 | DUF1841 family protein | - |
| OEG81_RS12940 (OEG81_12940) | 2747244..2747606 | - | 363 | WP_264129666.1 | cytochrome c | - |
| OEG81_RS12945 (OEG81_12945) | 2747619..2747972 | - | 354 | WP_264129667.1 | c-type cytochrome | - |
| OEG81_RS12950 (OEG81_12950) | 2748128..2749000 | + | 873 | WP_264129668.1 | MoxR family ATPase | - |
| OEG81_RS12955 (OEG81_12955) | 2749050..2749664 | + | 615 | WP_264129669.1 | GNAT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10947.68 Da Isoelectric Point: 10.0424
>T261728 WP_264129663.1 NZ_CP107548:c2745078-2744782 [Pusillimonas sp. M17]
MFTVKQTPEFERWIGGLKDGMARIRLAKRLDKVQRGNLGDVAPIGEGVSEMREHFGPGWRMYYVQRGDVLIVMLGGGDKS
TQNADIKQAIALAKTLQE
MFTVKQTPEFERWIGGLKDGMARIRLAKRLDKVQRGNLGDVAPIGEGVSEMREHFGPGWRMYYVQRGDVLIVMLGGGDKS
TQNADIKQAIALAKTLQE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|