Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1709440..1710110 | Replicon | chromosome |
Accession | NZ_CP107548 | ||
Organism | Pusillimonas sp. M17 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OEG81_RS08135 | Protein ID | WP_264132220.1 |
Coordinates | 1709685..1710110 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OEG81_RS08130 | Protein ID | WP_264132219.1 |
Coordinates | 1709440..1709688 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG81_RS08105 (OEG81_08105) | 1704736..1705209 | - | 474 | WP_264132215.1 | GNAT family N-acetyltransferase | - |
OEG81_RS08110 (OEG81_08110) | 1705269..1706057 | - | 789 | WP_264132216.1 | alpha/beta fold hydrolase | - |
OEG81_RS08115 (OEG81_08115) | 1706100..1707284 | - | 1185 | WP_264132217.1 | YbfB/YjiJ family MFS transporter | - |
OEG81_RS08120 (OEG81_08120) | 1707394..1708980 | + | 1587 | WP_264132218.1 | glutamine-hydrolyzing GMP synthase | - |
OEG81_RS08125 (OEG81_08125) | 1709059..1709145 | + | 87 | Protein_1596 | conjugal transfer protein TraJ | - |
OEG81_RS08130 (OEG81_08130) | 1709440..1709688 | + | 249 | WP_264132219.1 | Arc family DNA-binding protein | Antitoxin |
OEG81_RS08135 (OEG81_08135) | 1709685..1710110 | + | 426 | WP_264132220.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OEG81_RS08140 (OEG81_08140) | 1710237..1711754 | - | 1518 | WP_264132221.1 | FAD-dependent oxidoreductase | - |
OEG81_RS08145 (OEG81_08145) | 1711799..1712302 | + | 504 | WP_264132222.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OEG81_RS08150 (OEG81_08150) | 1712413..1713180 | + | 768 | WP_264132223.1 | DUF72 domain-containing protein | - |
OEG81_RS08155 (OEG81_08155) | 1713262..1714068 | - | 807 | WP_264132224.1 | DUF72 domain-containing protein | - |
OEG81_RS08160 (OEG81_08160) | 1714296..1715033 | + | 738 | WP_264132535.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15248.56 Da Isoelectric Point: 4.4237
>T261727 WP_264132220.1 NZ_CP107548:1709685-1710110 [Pusillimonas sp. M17]
MILLDTNVISEQFRAVPDESVIDWLNRQPLETLYLASMTVAELRACVALMPAGKRRTVLSDNIEHQVLPVFVGRVLSFDM
ACTRAYADVLAAARKSGSGIEAADAIIAAIALDNGFSVATRDVSPFLAAGVKVISPWEDQE
MILLDTNVISEQFRAVPDESVIDWLNRQPLETLYLASMTVAELRACVALMPAGKRRTVLSDNIEHQVLPVFVGRVLSFDM
ACTRAYADVLAAARKSGSGIEAADAIIAAIALDNGFSVATRDVSPFLAAGVKVISPWEDQE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|