Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 1380950..1381497 Replicon chromosome
Accession NZ_CP107548
Organism Pusillimonas sp. M17

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag OEG81_RS06565 Protein ID WP_264131915.1
Coordinates 1380950..1381273 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag OEG81_RS06570 Protein ID WP_264131917.1
Coordinates 1381273..1381497 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG81_RS06550 (OEG81_06550) 1377129..1378499 + 1371 Protein_1287 methyl-accepting chemotaxis protein -
OEG81_RS06555 (OEG81_06555) 1378502..1379041 + 540 WP_264131912.1 hypothetical protein -
OEG81_RS06560 (OEG81_06560) 1379105..1380829 + 1725 WP_264131913.1 methyl-accepting chemotaxis protein -
OEG81_RS06565 (OEG81_06565) 1380950..1381273 - 324 WP_264131915.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OEG81_RS06570 (OEG81_06570) 1381273..1381497 - 225 WP_264131917.1 antitoxin MazE family protein Antitoxin
OEG81_RS06575 (OEG81_06575) 1381594..1382382 - 789 WP_264131918.1 flagellar biosynthetic protein FliR -
OEG81_RS06580 (OEG81_06580) 1382459..1382728 - 270 WP_264131919.1 flagellar biosynthesis protein FliQ -
OEG81_RS06585 (OEG81_06585) 1382739..1383494 - 756 WP_264132507.1 flagellar type III secretion system pore protein FliP -
OEG81_RS06590 (OEG81_06590) 1383546..1383878 - 333 WP_264131921.1 flagellar biosynthetic protein FliO -
OEG81_RS06595 (OEG81_06595) 1383886..1384428 - 543 WP_264131922.1 flagellar motor switch protein FliN -
OEG81_RS06600 (OEG81_06600) 1384439..1385431 - 993 WP_264131923.1 flagellar motor switch protein FliM -
OEG81_RS06605 (OEG81_06605) 1385432..1385911 - 480 WP_264131924.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(8-72)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11833.84 Da        Isoelectric Point: 8.7032

>T261725 WP_264131915.1 NZ_CP107548:c1381273-1380950 [Pusillimonas sp. M17]
MRGDLVTISVQGDFGKSRPALIIQTNHFATHPTLTVLLITSTLIEAPLFRITVYPDDENRLQAPSQVMVDKVMTIRRDKA
APAFGRIAENTMVEIDRALAIFLGIAK

Download         Length: 324 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8474.54 Da        Isoelectric Point: 5.6388

>AT261725 WP_264131917.1 NZ_CP107548:c1381497-1381273 [Pusillimonas sp. M17]
MTASHVNDRVRKYRQSLRMAGLRPIQIWVPDTQQPNFGKECHRQSMLAAQADAMDTETSTLLDEALSDIEGWKE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References