Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1205754..1206359 | Replicon | chromosome |
| Accession | NZ_CP107548 | ||
| Organism | Pusillimonas sp. M17 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OEG81_RS05800 | Protein ID | WP_264131758.1 |
| Coordinates | 1206069..1206359 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | OEG81_RS05795 | Protein ID | WP_264131757.1 |
| Coordinates | 1205754..1206056 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG81_RS05770 (OEG81_05770) | 1201087..1202247 | + | 1161 | WP_264131752.1 | ABC transporter substrate-binding protein | - |
| OEG81_RS05775 (OEG81_05775) | 1202291..1203160 | - | 870 | WP_264131753.1 | hypothetical protein | - |
| OEG81_RS05780 (OEG81_05780) | 1203290..1204420 | + | 1131 | WP_264131754.1 | cupin domain-containing protein | - |
| OEG81_RS05785 (OEG81_05785) | 1204515..1205465 | + | 951 | WP_264131755.1 | LysR family transcriptional regulator | - |
| OEG81_RS05790 (OEG81_05790) | 1205438..1205683 | - | 246 | WP_264131756.1 | hypothetical protein | - |
| OEG81_RS05795 (OEG81_05795) | 1205754..1206056 | - | 303 | WP_264131757.1 | putative addiction module antidote protein | Antitoxin |
| OEG81_RS05800 (OEG81_05800) | 1206069..1206359 | - | 291 | WP_264131758.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OEG81_RS05805 (OEG81_05805) | 1206523..1206813 | + | 291 | Protein_1140 | transposase | - |
| OEG81_RS05810 (OEG81_05810) | 1207320..1208012 | + | 693 | WP_264131759.1 | HAD family phosphatase | - |
| OEG81_RS05815 (OEG81_05815) | 1208110..1208922 | - | 813 | WP_264131760.1 | arylamine N-acetyltransferase | - |
| OEG81_RS05820 (OEG81_05820) | 1209249..1210910 | + | 1662 | WP_264131761.1 | CTP synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1206523..1206867 | 344 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10961.51 Da Isoelectric Point: 8.0307
>T261724 WP_264131758.1 NZ_CP107548:c1206359-1206069 [Pusillimonas sp. M17]
MKTIHTTDTFDDWFVGLRDRMAQKRIQARIRRAEFGNFGDCEPVGEGVSEMRIHYGPGYRVYFVQRGLEIVILLAGGDKS
TQSQDIKTALNLVQQL
MKTIHTTDTFDDWFVGLRDRMAQKRIQARIRRAEFGNFGDCEPVGEGVSEMRIHYGPGYRVYFVQRGLEIVILLAGGDKS
TQSQDIKTALNLVQQL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|