Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 981282..981873 | Replicon | chromosome |
| Accession | NZ_CP107548 | ||
| Organism | Pusillimonas sp. M17 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OEG81_RS04710 | Protein ID | WP_264131566.1 |
| Coordinates | 981577..981873 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | OEG81_RS04705 | Protein ID | WP_264131565.1 |
| Coordinates | 981282..981575 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG81_RS04680 (OEG81_04680) | 976416..977372 | + | 957 | WP_264131561.1 | LysR family transcriptional regulator | - |
| OEG81_RS04685 (OEG81_04685) | 977422..978717 | - | 1296 | WP_264131562.1 | phospholipase A | - |
| OEG81_RS04695 (OEG81_04695) | 979026..980696 | + | 1671 | WP_264131563.1 | ATP-binding cassette domain-containing protein | - |
| OEG81_RS04700 (OEG81_04700) | 980856..981155 | + | 300 | WP_264131564.1 | putative quinol monooxygenase | - |
| OEG81_RS04705 (OEG81_04705) | 981282..981575 | - | 294 | WP_264131565.1 | putative addiction module antidote protein | Antitoxin |
| OEG81_RS04710 (OEG81_04710) | 981577..981873 | - | 297 | WP_264131566.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OEG81_RS04715 (OEG81_04715) | 982052..982642 | - | 591 | WP_264131567.1 | TetR/AcrR family transcriptional regulator | - |
| OEG81_RS04720 (OEG81_04720) | 982719..983432 | + | 714 | WP_264131568.1 | SDR family oxidoreductase | - |
| OEG81_RS04725 (OEG81_04725) | 983524..984141 | - | 618 | WP_264131569.1 | nucleotidyltransferase family protein | - |
| OEG81_RS04730 (OEG81_04730) | 984278..985177 | - | 900 | WP_264131570.1 | LysR family transcriptional regulator | - |
| OEG81_RS04735 (OEG81_04735) | 985279..986478 | + | 1200 | WP_264131571.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11146.94 Da Isoelectric Point: 10.1887
>T261723 WP_264131566.1 NZ_CP107548:c981873-981577 [Pusillimonas sp. M17]
MIELKQTKTYEKWEARLRDKRAKTIIAARLMRLAEGLPGDIESVGEGVNELRIHYGPGYRVYFQRRGNLLVVLLCGGDKS
TQARDIAAAKKLAKEWSE
MIELKQTKTYEKWEARLRDKRAKTIIAARLMRLAEGLPGDIESVGEGVNELRIHYGPGYRVYFQRRGNLLVVLLCGGDKS
TQARDIAAAKKLAKEWSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|