Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 1170607..1171164 | Replicon | chromosome |
| Accession | NZ_CP107524 | ||
| Organism | Streptococcus agalactiae strain SA5087 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G5KI09 |
| Locus tag | OFY20_RS06190 | Protein ID | WP_003047235.1 |
| Coordinates | 1170892..1171164 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G5KI08 |
| Locus tag | OFY20_RS06185 | Protein ID | WP_001140275.1 |
| Coordinates | 1170607..1170888 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFY20_RS06155 (OFY20_06155) | 1165971..1166420 | - | 450 | WP_050152615.1 | DUF4314 domain-containing protein | - |
| OFY20_RS06160 (OFY20_06160) | 1166422..1166673 | - | 252 | WP_017646680.1 | hypothetical protein | - |
| OFY20_RS06165 (OFY20_06165) | 1166735..1168015 | - | 1281 | WP_050152616.1 | DNA (cytosine-5-)-methyltransferase | - |
| OFY20_RS06170 (OFY20_06170) | 1168012..1168602 | - | 591 | WP_000073292.1 | HNH endonuclease | - |
| OFY20_RS06175 (OFY20_06175) | 1168602..1169855 | - | 1254 | WP_006740451.1 | site-specific DNA-methyltransferase | - |
| OFY20_RS06180 (OFY20_06180) | 1169827..1170282 | - | 456 | WP_000999415.1 | hypothetical protein | - |
| OFY20_RS06185 (OFY20_06185) | 1170607..1170888 | + | 282 | WP_001140275.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OFY20_RS06190 (OFY20_06190) | 1170892..1171164 | + | 273 | WP_003047235.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OFY20_RS06195 (OFY20_06195) | 1171207..1171566 | - | 360 | WP_001138026.1 | HNH endonuclease | - |
| OFY20_RS06200 (OFY20_06200) | 1171568..1172308 | - | 741 | WP_003047233.1 | methionine adenosyltransferase domain-containing protein | - |
| OFY20_RS06205 (OFY20_06205) | 1172712..1173209 | - | 498 | WP_006738435.1 | hypothetical protein | - |
| OFY20_RS06210 (OFY20_06210) | 1173202..1174578 | - | 1377 | WP_000773770.1 | DEAD/DEAH box helicase | - |
| OFY20_RS06215 (OFY20_06215) | 1174559..1174840 | - | 282 | WP_001208489.1 | VRR-NUC domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1143125..1181792 | 38667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10433.06 Da Isoelectric Point: 8.9949
>T261715 WP_003047235.1 NZ_CP107524:1170892-1171164 [Streptococcus agalactiae]
MLQLVTTNQFRKDVKRAKKRGLNLKKLEAVLDPLQKEETLDEKHRDHALVGNYMGFRECHIEPDWLLVYAIDKGQLILTA
SRTGSHSDLF
MLQLVTTNQFRKDVKRAKKRGLNLKKLEAVLDPLQKEETLDEKHRDHALVGNYMGFRECHIEPDWLLVYAIDKGQLILTA
SRTGSHSDLF
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|