Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 238157..238769 | Replicon | chromosome |
| Accession | NZ_CP107524 | ||
| Organism | Streptococcus agalactiae strain SA5087 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q8E7D3 |
| Locus tag | OFY20_RS01395 | Protein ID | WP_000384859.1 |
| Coordinates | 238157..238492 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | OFY20_RS01400 | Protein ID | WP_000259017.1 |
| Coordinates | 238482..238769 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFY20_RS01370 (OFY20_01370) | 233355..233996 | + | 642 | WP_000591145.1 | hypothetical protein | - |
| OFY20_RS01375 (OFY20_01375) | 234296..235171 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| OFY20_RS01380 (OFY20_01380) | 235207..235641 | + | 435 | WP_001220482.1 | hypothetical protein | - |
| OFY20_RS01385 (OFY20_01385) | 235958..237214 | + | 1257 | WP_000122836.1 | MobV family relaxase | - |
| OFY20_RS01390 (OFY20_01390) | 237382..237852 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| OFY20_RS01395 (OFY20_01395) | 238157..238492 | - | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OFY20_RS01400 (OFY20_01400) | 238482..238769 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| OFY20_RS01405 (OFY20_01405) | 239276..239566 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| OFY20_RS01410 (OFY20_01410) | 239668..240075 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| OFY20_RS01415 (OFY20_01415) | 240075..240635 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| OFY20_RS01420 (OFY20_01420) | 240608..240871 | + | 264 | Protein_224 | hypothetical protein | - |
| OFY20_RS01425 (OFY20_01425) | 240908..241713 | + | 806 | WP_088181596.1 | IS5-like element IS1381A family transposase | - |
| OFY20_RS01430 (OFY20_01430) | 241730..242149 | + | 420 | Protein_226 | hypothetical protein | - |
| OFY20_RS01435 (OFY20_01435) | 242134..242520 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| OFY20_RS01440 (OFY20_01440) | 242554..242835 | + | 282 | WP_000052406.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 230187..239043 | 8856 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T261714 WP_000384859.1 NZ_CP107524:c238492-238157 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|