Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2428421..2429072 | Replicon | chromosome |
Accession | NZ_CP107523 | ||
Organism | Lacticaseibacillus chiayiensis strain AACE 3 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OFW50_RS11765 | Protein ID | WP_129301156.1 |
Coordinates | 2428421..2428804 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0R1EMB2 |
Locus tag | OFW50_RS11770 | Protein ID | WP_010491246.1 |
Coordinates | 2428824..2429072 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OFW50_RS11740 (OFW50_11740) | 2423945..2425195 | - | 1251 | WP_213224100.1 | RNA-guided endonuclease TnpB family protein | - |
OFW50_RS11745 (OFW50_11745) | 2425270..2425719 | + | 450 | WP_129302982.1 | IS200/IS605 family transposase | - |
OFW50_RS11750 (OFW50_11750) | 2425963..2426661 | + | 699 | WP_129302926.1 | L,D-transpeptidase | - |
OFW50_RS11755 (OFW50_11755) | 2426736..2427629 | - | 894 | WP_129302966.1 | IS3 family transposase | - |
OFW50_RS11760 (OFW50_11760) | 2427626..2428303 | - | 678 | WP_129302967.1 | helix-turn-helix domain-containing protein | - |
OFW50_RS11765 (OFW50_11765) | 2428421..2428804 | - | 384 | WP_129301156.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OFW50_RS11770 (OFW50_11770) | 2428824..2429072 | - | 249 | WP_010491246.1 | antitoxin | Antitoxin |
OFW50_RS11775 (OFW50_11775) | 2429171..2430310 | - | 1140 | WP_129301157.1 | alanine racemase | - |
OFW50_RS11780 (OFW50_11780) | 2430297..2430671 | - | 375 | WP_049170363.1 | holo-ACP synthase | - |
OFW50_RS11785 (OFW50_11785) | 2430913..2432424 | - | 1512 | WP_129301158.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13784.06 Da Isoelectric Point: 10.9764
>T261713 WP_129301156.1 NZ_CP107523:c2428804-2428421 [Lacticaseibacillus chiayiensis]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVNLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVNLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|