Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 126475..127118 Replicon plasmid unnamed1
Accession NZ_CP107514
Organism Klebsiella pneumoniae strain CRKP_2

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OH512_RS27615 Protein ID WP_014386165.1
Coordinates 126475..126891 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag OH512_RS27620 Protein ID WP_032408893.1
Coordinates 126888..127118 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH512_RS27590 123137..123529 + 393 Protein_134 conjugation system SOS inhibitor PsiB -
OH512_RS27595 123526..124251 + 726 Protein_135 plasmid SOS inhibition protein A -
OH512_RS27600 124248..124574 + 327 WP_001568059.1 hypothetical protein -
OH512_RS27605 124630..125004 + 375 WP_032408891.1 hypothetical protein -
OH512_RS27610 125184..126152 - 969 WP_074422984.1 IS5-like element IS903B family transposase -
OH512_RS27615 126475..126891 - 417 WP_014386165.1 PIN domain-containing protein Toxin
OH512_RS27620 126888..127118 - 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH512_RS27625 127438..127872 + 435 WP_000103648.1 RidA family protein -
OH512_RS27630 127877..128551 + 675 WP_014386166.1 DUF1028 domain-containing protein -
OH512_RS27635 128567..129724 + 1158 WP_032408895.1 acetylornithine deacetylase -
OH512_RS27640 129895..131043 + 1149 WP_014386168.1 ABC transporter ATP-binding protein -
OH512_RS27645 131062..132045 + 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia - 1..206705 206705
- flank IS/Tn - - 125184..126152 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T261676 WP_014386165.1 NZ_CP107514:c126891-126475 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT261676 WP_032408893.1 NZ_CP107514:c127118-126888 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References