Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1428226..1428845 Replicon chromosome
Accession NZ_CP107498
Organism Klebsiella pneumoniae strain CRKP_5

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH531_RS07170 Protein ID WP_002892050.1
Coordinates 1428627..1428845 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH531_RS07165 Protein ID WP_002892066.1
Coordinates 1428226..1428600 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH531_RS07155 1423378..1424571 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OH531_RS07160 1424594..1427740 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH531_RS07165 1428226..1428600 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH531_RS07170 1428627..1428845 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OH531_RS07175 1429004..1429570 + 567 WP_002892030.1 maltose O-acetyltransferase -
OH531_RS07180 1429542..1429682 - 141 WP_004147370.1 hypothetical protein -
OH531_RS07185 1429703..1430173 + 471 WP_002892026.1 YlaC family protein -
OH531_RS07190 1430148..1431599 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH531_RS07195 1431700..1432398 + 699 WP_002892021.1 GNAT family protein -
OH531_RS07200 1432395..1432535 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH531_RS07205 1432535..1432798 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261586 WP_002892050.1 NZ_CP107498:1428627-1428845 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261586 WP_002892066.1 NZ_CP107498:1428226-1428600 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References