Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 149205..149950 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107494 | ||
| Organism | Klebsiella pneumoniae strain CRKP_6 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | OH495_RS27775 | Protein ID | WP_032408901.1 |
| Coordinates | 149205..149696 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | OH495_RS27780 | Protein ID | WP_014386183.1 |
| Coordinates | 149684..149950 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH495_RS27750 | 144889..145644 | + | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OH495_RS27755 | 145906..146346 | + | 441 | WP_014386179.1 | transposase | - |
| OH495_RS27760 | 146343..146693 | + | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OH495_RS27765 | 146724..148316 | + | 1593 | Protein_162 | IS66 family transposase | - |
| OH495_RS27770 | 148513..148764 | + | 252 | WP_032408900.1 | aldo/keto reductase | - |
| OH495_RS27775 | 149205..149696 | - | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| OH495_RS27780 | 149684..149950 | - | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| OH495_RS27785 | 150186..150305 | + | 120 | WP_223156217.1 | type I toxin-antitoxin system Hok family toxin | - |
| OH495_RS27790 | 150549..151034 | - | 486 | WP_014386185.1 | hypothetical protein | - |
| OH495_RS27795 | 151224..151496 | + | 273 | WP_032408902.1 | hypothetical protein | - |
| OH495_RS27800 | 151493..151843 | + | 351 | WP_014386186.1 | hypothetical protein | - |
| OH495_RS27805 | 152480..152806 | + | 327 | WP_014386187.1 | hypothetical protein | - |
| OH495_RS27810 | 152868..153080 | + | 213 | WP_014386188.1 | hypothetical protein | - |
| OH495_RS27815 | 153091..153315 | + | 225 | WP_014386189.1 | hypothetical protein | - |
| OH495_RS27820 | 153396..153716 | + | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OH495_RS27825 | 153706..153984 | + | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
| OH495_RS27830 | 153985..154398 | + | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205641 | 205641 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T261575 WP_032408901.1 NZ_CP107494:c149696-149205 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|