Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 125409..126052 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107489 | ||
Organism | Klebsiella pneumoniae strain CRKP_7 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | OH500_RS27645 | Protein ID | WP_014386165.1 |
Coordinates | 125409..125825 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | OH500_RS27650 | Protein ID | WP_032408893.1 |
Coordinates | 125822..126052 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH500_RS27620 | 122035..122463 | + | 429 | Protein_133 | conjugation system SOS inhibitor PsiB | - |
OH500_RS27625 | 122460..123185 | + | 726 | Protein_134 | plasmid SOS inhibition protein A | - |
OH500_RS27630 | 123182..123508 | + | 327 | WP_004152639.1 | hypothetical protein | - |
OH500_RS27635 | 123564..123938 | + | 375 | WP_032408891.1 | hypothetical protein | - |
OH500_RS27640 | 124118..125086 | - | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
OH500_RS27645 | 125409..125825 | - | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
OH500_RS27650 | 125822..126052 | - | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH500_RS27655 | 126372..126806 | + | 435 | WP_000103648.1 | RidA family protein | - |
OH500_RS27660 | 126811..127485 | + | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
OH500_RS27665 | 127501..128658 | + | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
OH500_RS27670 | 128829..129977 | + | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
OH500_RS27675 | 129996..130979 | + | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205638 | 205638 | |
- | flank | IS/Tn | - | - | 124118..125086 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T261548 WP_014386165.1 NZ_CP107489:c125825-125409 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|