Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 125409..126052 Replicon plasmid unnamed1
Accession NZ_CP107489
Organism Klebsiella pneumoniae strain CRKP_7

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag OH500_RS27645 Protein ID WP_014386165.1
Coordinates 125409..125825 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag OH500_RS27650 Protein ID WP_032408893.1
Coordinates 125822..126052 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH500_RS27620 122035..122463 + 429 Protein_133 conjugation system SOS inhibitor PsiB -
OH500_RS27625 122460..123185 + 726 Protein_134 plasmid SOS inhibition protein A -
OH500_RS27630 123182..123508 + 327 WP_004152639.1 hypothetical protein -
OH500_RS27635 123564..123938 + 375 WP_032408891.1 hypothetical protein -
OH500_RS27640 124118..125086 - 969 WP_074422984.1 IS5-like element IS903B family transposase -
OH500_RS27645 125409..125825 - 417 WP_014386165.1 PIN domain-containing protein Toxin
OH500_RS27650 125822..126052 - 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH500_RS27655 126372..126806 + 435 WP_000103648.1 RidA family protein -
OH500_RS27660 126811..127485 + 675 WP_014386166.1 DUF1028 domain-containing protein -
OH500_RS27665 127501..128658 + 1158 WP_032408895.1 acetylornithine deacetylase -
OH500_RS27670 128829..129977 + 1149 WP_014386168.1 ABC transporter ATP-binding protein -
OH500_RS27675 129996..130979 + 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia - 1..205638 205638
- flank IS/Tn - - 124118..125086 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T261548 WP_014386165.1 NZ_CP107489:c125825-125409 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT261548 WP_032408893.1 NZ_CP107489:c126052-125822 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References