Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 149200..149945 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107484 | ||
Organism | Klebsiella pneumoniae strain CRKP_8 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A331KSM6 |
Locus tag | OH502_RS27785 | Protein ID | WP_032408901.1 |
Coordinates | 149200..149691 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | OH502_RS27790 | Protein ID | WP_014386183.1 |
Coordinates | 149679..149945 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH502_RS27760 | 144884..145639 | + | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
OH502_RS27765 | 145901..146341 | + | 441 | WP_014386179.1 | transposase | - |
OH502_RS27770 | 146338..146688 | + | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OH502_RS27775 | 146719..148311 | + | 1593 | Protein_162 | IS66 family transposase | - |
OH502_RS27780 | 148508..148759 | + | 252 | WP_032408900.1 | aldo/keto reductase | - |
OH502_RS27785 | 149200..149691 | - | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
OH502_RS27790 | 149679..149945 | - | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
OH502_RS27795 | 150181..150300 | + | 120 | WP_223156217.1 | type I toxin-antitoxin system Hok family toxin | - |
OH502_RS27800 | 150544..151029 | - | 486 | WP_014386185.1 | hypothetical protein | - |
OH502_RS27805 | 151219..151491 | + | 273 | WP_032408902.1 | hypothetical protein | - |
OH502_RS27810 | 151488..151838 | + | 351 | WP_014386186.1 | hypothetical protein | - |
OH502_RS27815 | 152475..152801 | + | 327 | WP_014386187.1 | hypothetical protein | - |
OH502_RS27820 | 152863..153075 | + | 213 | WP_014386188.1 | hypothetical protein | - |
OH502_RS27825 | 153086..153310 | + | 225 | WP_014386189.1 | hypothetical protein | - |
OH502_RS27830 | 153391..153711 | + | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OH502_RS27835 | 153701..153979 | + | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
OH502_RS27840 | 153980..154393 | + | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205636 | 205636 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T261523 WP_032408901.1 NZ_CP107484:c149691-149200 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|