Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 125406..126049 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107484 | ||
Organism | Klebsiella pneumoniae strain CRKP_8 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | OH502_RS27655 | Protein ID | WP_014386165.1 |
Coordinates | 125406..125822 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | OH502_RS27660 | Protein ID | WP_032408893.1 |
Coordinates | 125819..126049 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH502_RS27630 | 122032..122459 | + | 428 | Protein_133 | conjugation system SOS inhibitor PsiB | - |
OH502_RS27635 | 122456..123182 | + | 727 | Protein_134 | plasmid SOS inhibition protein A | - |
OH502_RS27640 | 123179..123505 | + | 327 | WP_004152639.1 | hypothetical protein | - |
OH502_RS27645 | 123561..123935 | + | 375 | WP_032408891.1 | hypothetical protein | - |
OH502_RS27650 | 124115..125083 | - | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
OH502_RS27655 | 125406..125822 | - | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
OH502_RS27660 | 125819..126049 | - | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH502_RS27665 | 126369..126803 | + | 435 | WP_000103648.1 | RidA family protein | - |
OH502_RS27670 | 126808..127482 | + | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
OH502_RS27675 | 127498..128655 | + | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
OH502_RS27680 | 128826..129974 | + | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
OH502_RS27685 | 129993..130976 | + | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205636 | 205636 | |
- | flank | IS/Tn | - | - | 124115..125083 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T261522 WP_014386165.1 NZ_CP107484:c125822-125406 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|