Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 5690..6270 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP107481 | ||
| Organism | Klebsiella pneumoniae strain CRKP_9 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8J3DTL7 |
| Locus tag | OH537_RS29140 | Protein ID | WP_071177730.1 |
| Coordinates | 5690..6004 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1PRM1 |
| Locus tag | OH537_RS29145 | Protein ID | WP_000093040.1 |
| Coordinates | 5992..6270 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH537_RS29115 | 1634..3598 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
| OH537_RS29120 | 3598..4329 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
| OH537_RS29125 | 4336..4866 | + | 531 | WP_071177729.1 | hypothetical protein | - |
| OH537_RS29130 | 4893..5072 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
| OH537_RS29135 | 5098..5526 | - | 429 | WP_001140599.1 | hypothetical protein | - |
| OH537_RS29140 | 5690..6004 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH537_RS29145 | 5992..6270 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OH537_RS29150 | 6445..6810 | - | 366 | WP_072354022.1 | TonB family protein | - |
| OH537_RS29155 | 6807..7178 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
| OH537_RS29160 | 7452..7697 | - | 246 | WP_032440458.1 | hypothetical protein | - |
| OH537_RS29165 | 8024..9709 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
| OH537_RS29170 | 9719..9976 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T261506 WP_071177730.1 NZ_CP107481:c6004-5690 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|