Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 125316..125959 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107479 | ||
| Organism | Klebsiella pneumoniae strain CRKP_9 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OH537_RS27640 | Protein ID | WP_014386165.1 |
| Coordinates | 125316..125732 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | OH537_RS27645 | Protein ID | WP_032408893.1 |
| Coordinates | 125729..125959 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH537_RS27615 | 121936..122367 | + | 432 | WP_014386161.1 | conjugation system SOS inhibitor PsiB | - |
| OH537_RS27620 | 122364..123092 | + | 729 | WP_014386162.1 | plasmid SOS inhibition protein A | - |
| OH537_RS27625 | 123089..123415 | + | 327 | WP_001568059.1 | hypothetical protein | - |
| OH537_RS27630 | 123471..123845 | + | 375 | WP_032408891.1 | hypothetical protein | - |
| OH537_RS27635 | 124025..124993 | - | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
| OH537_RS27640 | 125316..125732 | - | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
| OH537_RS27645 | 125729..125959 | - | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH537_RS27650 | 126279..126713 | + | 435 | WP_000103648.1 | RidA family protein | - |
| OH537_RS27655 | 126718..127392 | + | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
| OH537_RS27660 | 127408..128565 | + | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
| OH537_RS27665 | 128736..129884 | + | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
| OH537_RS27670 | 129903..130886 | + | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia | - | 1..205545 | 205545 | |
| - | flank | IS/Tn | - | - | 124025..124993 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T261496 WP_014386165.1 NZ_CP107479:c125732-125316 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|