Detailed information of TA system TA261444

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): vagCD/VapC-VagC
• Location: 125411..126054
• Replicon: plasmid unnamed1
• Accession: NZ_CP107469
• Organism: Klebsiella pneumoniae strain CRKP_11

Toxin (Protein)

• Gene name: vagD
• Uniprot ID: -
• Locus tag: OH523_RS27625
• Protein ID: WP_014386165.1
• Coordinates: 125411..125827 (-)
• Length: 139 a.a.

Antitoxin (Protein)

• Gene name: vagC
• Uniprot ID: -
• Locus tag: OH523_RS27630
• Protein ID: WP_032408893.1
• Coordinates: 125824..126054 (-)
• Length: 77 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH523_RS27600	122035..122463	+	429	Protein_133	conjugation system SOS inhibitor PsiB	-
OH523_RS27605	122460..123187	+	728	Protein_134	plasmid SOS inhibition protein A	-
OH523_RS27610	123184..123510	+	327	WP_004152639.1	hypothetical protein	-
OH523_RS27615	123566..123940	+	375	WP_032408891.1	hypothetical protein	-
OH523_RS27620	124120..125088	-	969	WP_074422984.1	IS5-like element IS903B family transposase	-
OH523_RS27625	125411..125827	-	417	WP_014386165.1	PIN domain-containing protein	Toxin
OH523_RS27630	125824..126054	-	231	WP_032408893.1	type II toxin-antitoxin system VapB family antitoxin	Antitoxin
OH523_RS27635	126374..126808	+	435	WP_000103648.1	RidA family protein	-
OH523_RS27640	126813..127487	+	675	WP_014386166.1	DUF1028 domain-containing protein	-
OH523_RS27645	127503..128660	+	1158	WP_032408895.1	acetylornithine deacetylase	-
OH523_RS27650	128831..129979	+	1149	WP_014386168.1	ABC transporter ATP-binding protein	-
OH523_RS27655	129998..130981	+	984	WP_001471744.1	NAD(P)H-quinone oxidoreductase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / sul1 / qacE / aadA2 / dfrA12 / aph(3')-Ia	-	1..205641	205641
	-	flank	IS/Tn	-	-	124120..125088	968

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• PIN domain (5-130)

Antitoxin

• SpoVT-AbrB domain (7-55)

Sequences

Toxin

Protein

• Length: 139 a.a.
• Molecular weight: 15127.44 Da
• Isoelectric Point: 7.8841

>T261444 WP_014386165.1 NZ_CP107469:c125827-125411 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Nucleotide

• Length: 417 bp

Antitoxin

Protein

• Length: 77 a.a.
• Molecular weight: 8854.89 Da
• Isoelectric Point: 4.5112

>AT261444 WP_032408893.1 NZ_CP107469:c126054-125824 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Nucleotide

• Length: 231 bp