Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 78264..78907 Replicon plasmid unnamed1
Accession NZ_CP107464
Organism Klebsiella pneumoniae strain CRKP_12

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH534_RS27405 Protein ID WP_001044770.1
Coordinates 78264..78680 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH534_RS27410 Protein ID WP_001261282.1
Coordinates 78677..78907 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH534_RS27385 (74367) 74367..74639 - 273 Protein_101 transposase -
OH534_RS27395 (75621) 75621..76643 - 1023 WP_000361404.1 helicase UvrD -
OH534_RS27400 (76628) 76628..78190 - 1563 WP_004206609.1 AAA family ATPase -
OH534_RS27405 (78264) 78264..78680 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH534_RS27410 (78677) 78677..78907 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH534_RS27415 (78864) 78864..79325 + 462 WP_014343465.1 hypothetical protein -
OH534_RS27420 (79486) 79486..80430 + 945 WP_011977810.1 hypothetical protein -
OH534_RS27425 (80467) 80467..80859 + 393 WP_011977811.1 hypothetical protein -
OH534_RS27430 (80917) 80917..81438 + 522 WP_013214008.1 hypothetical protein -
OH534_RS27435 (81484) 81484..81687 + 204 WP_011977813.1 hypothetical protein -
OH534_RS27440 (81717) 81717..82721 + 1005 WP_011977814.1 hypothetical protein -
OH534_RS27445 (82905) 82905..83684 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB - 1..128751 128751


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T261427 WP_001044770.1 NZ_CP107464:c78680-78264 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT261427 WP_001261282.1 NZ_CP107464:c78907-78677 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References