Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 78264..78907 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107464 | ||
| Organism | Klebsiella pneumoniae strain CRKP_12 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH534_RS27405 | Protein ID | WP_001044770.1 |
| Coordinates | 78264..78680 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH534_RS27410 | Protein ID | WP_001261282.1 |
| Coordinates | 78677..78907 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH534_RS27385 (74367) | 74367..74639 | - | 273 | Protein_101 | transposase | - |
| OH534_RS27395 (75621) | 75621..76643 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH534_RS27400 (76628) | 76628..78190 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH534_RS27405 (78264) | 78264..78680 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH534_RS27410 (78677) | 78677..78907 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH534_RS27415 (78864) | 78864..79325 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| OH534_RS27420 (79486) | 79486..80430 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| OH534_RS27425 (80467) | 80467..80859 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| OH534_RS27430 (80917) | 80917..81438 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| OH534_RS27435 (81484) | 81484..81687 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| OH534_RS27440 (81717) | 81717..82721 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH534_RS27445 (82905) | 82905..83684 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | - | 1..128751 | 128751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T261427 WP_001044770.1 NZ_CP107464:c78680-78264 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |