Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4791582..4792392 | Replicon | chromosome |
Accession | NZ_CP107463 | ||
Organism | Klebsiella pneumoniae strain CRKP_12 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0H3GMP0 |
Locus tag | OH534_RS23700 | Protein ID | WP_002887280.1 |
Coordinates | 4791582..4792115 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | OH534_RS23705 | Protein ID | WP_002887278.1 |
Coordinates | 4792126..4792392 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH534_RS23695 | 4790413..4791534 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
OH534_RS23700 | 4791582..4792115 | - | 534 | WP_002887280.1 | type II toxin-antitoxin system toxin KacT | Toxin |
OH534_RS23705 | 4792126..4792392 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
OH534_RS23710 | 4792495..4793928 | - | 1434 | WP_002887275.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
OH534_RS23715 | 4793918..4794601 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
OH534_RS23720 | 4794773..4796158 | + | 1386 | WP_002887267.1 | efflux transporter outer membrane subunit | - |
OH534_RS23725 | 4796176..4796520 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19838.70 Da Isoelectric Point: 5.2614
>T261416 WP_002887280.1 NZ_CP107463:c4792115-4791582 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
PDB | 5XUN |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |